DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and SDG11

DIOPT Version :10

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_178647.1 Gene:SDG11 / 815142 AraportID:AT2G05900 Length:312 Species:Arabidopsis thaliana


Alignment Length:377 Identity:78/377 - (20%)
Similarity:117/377 - (31%) Gaps:164/377 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly  1276 GADCNVQNVEGDTPLHIACR-HSVTRM--CI---------ALIANGADLMIKNKAEQLPFDCIPN 1328
            |..||.:....:.||..|.| .|:.|:  |:         ..|.:|. .||.|:.|         
plant    62 GQPCNQKLERLNIPLEAAFRKKSIVRVVRCMKDEKRTNGNIYIYDGT-YMITNRWE--------- 116

  Fly  1329 EESECGRTV---------------GFNMQMRSFR-PLGLRTFVVCADASNGREARPIQVVRNELA 1377
            ||.:.|..|               |....::::| .|.:|..::..|.|||.|...:.:| ||: 
plant   117 EEGQNGFIVFKFKLVREPDQKPAFGIWKSIQNWRNGLSIRPGLILEDLSNGAENLKVCLV-NEV- 179

  Fly  1378 MSENEDEADSLMWPDFRYVTQCIIQQ-NSVQIDRRVSQMRICSCLDSCSSDRCQCNGASSQNWYT 1441
               :::...:|    |||||..|.:. |::                                   
plant   180 ---DKENGPAL----FRYVTSLIHEVINNI----------------------------------- 202

  Fly  1442 AESRLNADFNYEDPAVIFECNDVCGCNQLSCKNRVVQNGTRTPLQIVECEDQAKGWGVRALANVP 1506
                         |:::    |.|.|.:.||.::.|   .|..|.:                   
plant   203 -------------PSMV----DRCACGRRSCGSKHV---FREKLSV------------------- 228

  Fly  1507 KGTFVGSYTGEILTAMEADRRTDDSYYFDLDNGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEH 1571
                                          .:...|.|...|||.||.||||.|||....:..|.
plant   229 ------------------------------SSSLVISAKKSGNVARFMNHSCSPNVFWQSIAREQ 263

  Fly  1572 QDYRFPKIAFFSCRDIDAGEEICFDYGEKFWRVEHRSCVG----CRCLTTTC 1619
            .......|.||:.:.|....|:.:|||        :|..|    |.|.|..|
plant   264 NGLWCLYIGFFAMKHIPPLTELRYDYG--------KSRGGGKKMCLCRTKKC 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 PTZ00121 <68..>188 CDD:173412
EHMT_ZBD 786..933 CDD:411018
ANKYR 1063..1322 CDD:440430 16/57 (28%)
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
ANK repeat 1251..1283 CDD:293786 3/6 (50%)
ANK repeat 1285..1316 CDD:293786 11/42 (26%)
SET_EHMT 1391..1622 CDD:380941 45/234 (19%)
SDG11NP_178647.1 SAD_SRA 1..136 CDD:470635 20/83 (24%)
Pre-SET 164..>215 CDD:461530 19/111 (17%)
SET <236..290 CDD:394802 20/53 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.