DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and SUV39H2

DIOPT Version :10

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_001180353.1 Gene:SUV39H2 / 79723 HGNCID:17287 Length:410 Species:Homo sapiens


Alignment Length:229 Identity:85/229 - (37%)
Similarity:118/229 - (51%) Gaps:39/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1418 CSCLDSCSSDRCQCNGASSQNWYTAESRLNADFNYED-----PAV-IFECNDVCGCNQLSCKNRV 1476
            |||.| |...:| |         .||:.:...:|...     |.. |:|||..|.|.. .|.||:
Human   191 CSCTD-CFFQKC-C---------PAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGP-DCPNRI 243

  Fly  1477 VQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEILTAMEADRR---TDD---SYYFD 1535
            ||.||:..|.|....: .:||||:.|..:.:.:||..|.||::|:.||:||   .|:   :|.||
Human   244 VQKGTQYSLCIFRTSN-GRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFD 307

  Fly  1536 LD---NGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKIAFFSCRDIDAGEEICFDY 1597
            ||   :...:||..||||:.|.||||:||:....||.::.|.|.|:||.||.|.|:||||:.|||
Human   308 LDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDY 372

  Fly  1598 GEK------FWRVEH-----RSCVGCRCLTTTCK 1620
            ..|      ...::|     |....|:|...||:
Human   373 QMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCR 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 PTZ00121 <68..>188 CDD:173412
EHMT_ZBD 786..933 CDD:411018
ANKYR 1063..1322 CDD:440430
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
SET_EHMT 1391..1622 CDD:380941 85/229 (37%)
SUV39H2NP_001180353.1 CD_SUV39H1_like 47..95 CDD:349289
SET_SUV39H2 167..409 CDD:380930 85/229 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.