DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and Setmar

DIOPT Version :9

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_848478.2 Gene:Setmar / 74729 MGIID:1921979 Length:309 Species:Mus musculus


Alignment Length:319 Identity:98/319 - (30%)
Similarity:141/319 - (44%) Gaps:73/319 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1360 ASNGREARPIQVVRNE---LAMSENEDEADSL------MWP--------DFRYVTQCIIQQNSVQ 1407
            ::.|.|...:::..:|   :|.:|.:|.|..|      :||        .|:| |...:......
Mouse     2 SAEGVEKLSLEIAASEEESVAPTEQQDVACGLENLPVSLWPLGAEPRPKPFQY-TPDHVAGPGAD 65

  Fly  1408 IDRRVSQMRICSCLDS-CSSDRCQCNGASSQNWYTAESRLNADFNYED-------------PAVI 1458
            ||........|:|::: |....|.|              |..:.||:|             ...:
Mouse    66 IDPTQITFPGCACIETPCVPGTCSC--------------LRHENNYDDNLCLRDVGSEGKYAKPV 116

  Fly  1459 FECNDVCGCNQLSCKNRVVQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEILTAME 1523
            ||||.:|.|. :.|:|||||||....||:.:.|  .||||:|.|..:|||.||..|.||:|...|
Mouse   117 FECNVLCQCG-MRCRNRVVQNGLHFLLQVFQTE--KKGWGLRTLEFIPKGRFVCEYAGEVLGFSE 178

  Fly  1524 ADRR-----TDDSYYFDLDNGHC---------IDANYYGNVTRFFNHSCEPNVL--PVRVFYEHQ 1572
            ..||     :.||.|......|.         :|..|.||:.||.|||||||:|  |||:     
Mouse   179 VQRRIHLQTSHDSNYIIAVREHIYSGQIMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRI----- 238

  Fly  1573 DYRFPKIAFFSCRDIDAGEEICFDYGEKFWR---VEHRSCVGCRCLTTTCKYASQSSST 1628
            |...||:|.|:.:||..|||:.:||..:|..   .:.:..:.|......|...:||.:|
Mouse   239 DSMVPKLALFAAKDILPGEELSYDYSGRFLNQVSSKDKEKIDCSPPRKPCYCGAQSCTT 297

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744 28/136 (21%)
SET 1495..1602 CDD:214614 51/122 (42%)
SetmarNP_848478.2 Pre-SET 29..132 CDD:282838 25/118 (21%)
SET 142..269 CDD:214614 55/133 (41%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250|UniProtKB:Q53H47 150..152 1/1 (100%)