DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and ezh1

DIOPT Version :9

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_001035072.2 Gene:ezh1 / 664754 ZFINID:ZDB-GENE-050114-1 Length:756 Species:Danio rerio


Alignment Length:213 Identity:70/213 - (32%)
Similarity:93/213 - (43%) Gaps:36/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1399 CIIQQN----SVQIDRRVSQMRI--CSCLDSCSSDRCQCNGASSQNWYTAESRLNADFNYEDPAV 1457
            |:|.||    ..|.||. .|.|.  |.|...|::.:|.|        |.|....       ||.:
Zfish   546 CVITQNFCEKFCQCDRE-CQNRFPGCRCKTQCNTKQCPC--------YLAVREC-------DPDL 594

  Fly  1458 IFECN--DVCGCNQLSCKNRVVQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEILT 1520
            ...|.  |.....|:||||..:|.|.:..|.:...:  ..|||......|.|..|:..|.||:::
Zfish   595 CMTCGAADHWDSKQVSCKNCSIQRGLKKHLLLAPSD--VAGWGTFIKEPVQKNEFISEYCGELIS 657

  Fly  1521 AMEADRRTD------DSYYFDLDNGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKI 1579
            ..|||||..      .|:.|:|:|...:||...||..||.|||..||.. .:|...:.|:|   |
Zfish   658 QDEADRRGRIYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCY-AKVVMVNGDHR---I 718

  Fly  1580 AFFSCRDIDAGEEICFDY 1597
            ..|:.|.|..|||:.|||
Zfish   719 GIFAKRAIQQGEELFFDY 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744 20/74 (27%)
SET 1495..1602 CDD:214614 42/109 (39%)
ezh1NP_001035072.2 EZH2_WD-Binding 45..73 CDD:288468
SANT 447..489 CDD:238096
SET <476..736 CDD:225491 68/211 (32%)
SET 622..743 CDD:214614 43/121 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.