DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and Setmar

DIOPT Version :9

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_001020219.1 Gene:Setmar / 500281 RGDID:1565882 Length:315 Species:Rattus norvegicus


Alignment Length:325 Identity:101/325 - (31%)
Similarity:149/325 - (45%) Gaps:58/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1366 ARPIQVVRNELAMSENEDEA-----------DSL---MWP--------DFRYVTQCIIQQNSVQI 1408
            |..::.:..|:|.||.|.||           ::|   :||        .|:|....:....   :
  Rat     3 AEAVKKLSFEIAPSEEESEATIEQQDVACGLENLPVSLWPLGAGPRPKPFQYTPDHVAGPG---V 64

  Fly  1409 DRRVSQMRI--CSCLDS-CSSDRCQC-NGASSQNWYTAESRLNADFNYEDPAVIFECNDVCGCNQ 1469
            |...:|:..  |:|:.: |....|.| ...|:.|.......:.::..|..|  :||||.:|.|.:
  Rat    65 DMDPTQITFPGCACIKTPCVPGTCSCLRHESNYNDNLCLRDVGSEAKYAKP--VFECNVLCQCGE 127

  Fly  1470 LSCKNRVVQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEILTAMEADRRT------ 1528
             .|:|||||:|.:..||:.:.|  .||||:|.|..:|||.||..|.||:|...|..||.      
  Rat   128 -HCRNRVVQSGLQFLLQVFQTE--KKGWGLRTLEYIPKGRFVCEYAGEVLGFSEVQRRIHLQTAH 189

  Fly  1529 DDSYYFDLD----NGHC----IDANYYGNVTRFFNHSCEPNVL--PVRVFYEHQDYRFPKIAFFS 1583
            |.:|...|.    ||..    :|..|.||:.||.|||||||:|  |||:     |...||:|.|:
  Rat   190 DPNYIIALREHTYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRI-----DSMVPKLALFA 249

  Fly  1584 CRDIDAGEEICFDYGEKFWR---VEHRSCVGCRCLTTTCKYASQSSSTNASPTNATTAPENETGT 1645
            .:||..|||:.:||..:|..   .:.:..:.|......|...:||.:|.....::...|....||
  Rat   250 AKDILPGEELSYDYSGRFLNQISSKDKERIDCGQPRKPCYCGAQSCATFLPYDSSLYGPLENPGT 314

  Fly  1646  1645
              Rat   315  314

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744 28/125 (22%)
SET 1495..1602 CDD:214614 52/122 (43%)
SetmarNP_001020219.1 Pre-SET 29..132 CDD:282838 23/108 (21%)
SET 142..269 CDD:214614 56/133 (42%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250|UniProtKB:Q53H47 150..152 1/1 (100%)