DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and CG4565

DIOPT Version :9

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster


Alignment Length:280 Identity:82/280 - (29%)
Similarity:129/280 - (46%) Gaps:59/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1374 NELAMSENEDEAD-------SLMWP-----DFRYVTQCIIQQNSVQIDRRVSQMRICSCLDSC-S 1425
            :|.|.:::.:..|       |::.|     :|:::..   :.|||.::.       |.|..:| :
  Fly     4 SETAPNDDYEHPDGLDYILESVLMPSDGSKEFKFLAD---EYNSVLLNP-------CHCKGACEN 58

  Fly  1426 SDRCQCNGASSQNWYTAESRLNADFNYEDPAVIFECNDVCGCNQLSCKNRVVQNGTRTPLQIVEC 1490
            |:.|...|   |..:|.:.......|..:|  :.||||:|.|.:.:|.||:|.:|.|..|:|.:.
  Fly    59 SEVCAHGG---QYEFTEDGSELILRNSANP--VIECNDMCKCCRNTCSNRLVYSGPRKHLEIFDS 118

  Fly  1491 EDQAKGWGVRALANVPKGTFVGSYTGEILTAMEADRRTDDSYYFDLDNGHCIDANYY-------- 1547
            ...... |:|..|.:.||.::..|.||:||..||..|..|:....|.| :.:..|.|        
  Fly   119 PVYGSK-GLRTTAKITKGGYICEYAGELLTVPEARSRLHDNEKLGLMN-YILVLNEYTSDKKQQV 181

  Fly  1548 --------GNVTRFFNHSCEPN--VLPVRVFYEHQDYRFPKIAFFSCRDIDAGEEICFDYGEKFW 1602
                    ||:.|:.|||||||  :..||:     |...|||..|:.|||.|.||:||.||.:  
  Fly   182 TIVDPSRRGNIGRYLNHSCEPNCHIAAVRI-----DCPIPKIGIFAARDIAAKEELCFHYGGE-- 239

  Fly  1603 RVEHRSCVG---CRCLTTTC 1619
             .:::...|   |.|..:.|
  Fly   240 -GQYKKMTGGKTCLCGASKC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744 23/104 (22%)
SET 1495..1602 CDD:214614 45/124 (36%)
CG4565NP_001097743.1 Pre-SET 10..103 CDD:282838 24/107 (22%)
SET 111..239 CDD:214614 47/134 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464258
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1082
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563968at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.