DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and E(z)

DIOPT Version :10

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_001261682.1 Gene:E(z) / 39203 FlyBaseID:FBgn0000629 Length:765 Species:Drosophila melanogaster


Alignment Length:230 Identity:71/230 - (30%)
Similarity:95/230 - (41%) Gaps:45/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1399 CIIQQNSVQIDRRVSQMRICSCLDSCSSD----RC--QCNGASSQNWYTAESRLNADFNYEDPAV 1457
            ||..||..:        :.|:|...|.:.    ||  ||| ......|.|....:.|.       
  Fly   556 CIQTQNFCE--------KFCNCSSDCQNRFPGCRCKAQCN-TKQCPCYLAVRECDPDL------- 604

  Fly  1458 IFECNDVCGCNQ-----LSCKNRVVQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGE 1517
               | ..||.:|     ::|||..||.|....|.:...:  ..|||:.......|..|:..|.||
  Fly   605 ---C-QACGADQFKLTKITCKNVCVQRGLHKHLLMAPSD--IAGWGIFLKEGAQKNEFISEYCGE 663

  Fly  1518 ILTAMEADRRTD------DSYYFDLDNGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRF 1576
            |::..|||||..      .|:.|:|:|...:||...||..||.|||..||.. .:|.....|:| 
  Fly   664 IISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCY-AKVMMVTGDHR- 726

  Fly  1577 PKIAFFSCRDIDAGEEICFDYGEKFWRVEHRSCVG 1611
              |..|:.|.|..|||:.|||  ::...|....||
  Fly   727 --IGIFAKRAIQPGEELFFDY--RYGPTEQLKFVG 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 PTZ00121 <68..>188 CDD:173412
EHMT_ZBD 786..933 CDD:411018
ANKYR 1063..1322 CDD:440430
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
SET_EHMT 1391..1622 CDD:380941 71/230 (31%)
E(z)NP_001261682.1 PRC2_HTH_1 151..291 CDD:436286
SANT 452..492 CDD:238096
preSET_CXC 579..610 CDD:408079 10/42 (24%)
SET_EZH2 628..747 CDD:380995 44/126 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.