DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and Suv39h2

DIOPT Version :9

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:XP_038951911.1 Gene:Suv39h2 / 364785 RGDID:1306969 Length:511 Species:Rattus norvegicus


Alignment Length:305 Identity:92/305 - (30%)
Similarity:137/305 - (44%) Gaps:59/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1362 NGREARP------IQVVRNELAMSENEDEADSLMWPDFRYVTQ------CIIQQNSVQIDRRVSQ 1414
            |.:..:|      :|..|..:|:..         |.|  |:.:      .|..:|:|.::...|.
  Rat   216 NNKSLQPAVAEYIVQKARQRIALQR---------WQD--YLNRRKNHKGMIFVENTVDLEGPPSD 269

  Fly  1415 MRICS--------CLDSCSSDRCQCNGASSQNWYTAESRL------NADFNYEDPAVIFECNDVC 1465
            ....:        .|:|.::..|.|.....:....||:.:      |.....:....|:|||..|
  Rat   270 FYYINEYRPAPGITLNSEATFGCSCTNCFFEKCCPAEAGVVLAYNKNRQIKIQPGTPIYECNSRC 334

  Fly  1466 GCNQLSCKNRVVQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEILTAMEADRR--- 1527
            .|.. .|.||:||.||:..|.|....:.. ||||:.|..:.:.:||..|.||::|:.||:||   
  Rat   335 RCGP-DCPNRIVQKGTQYSLCIFRTSNGC-GWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQL 397

  Fly  1528 TDD---SYYFDLD---NGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKIAFFSCRD 1586
            .|:   :|.||||   :...:||..||||:.|.||||:||:....||.::.|.|.|:||.||.|.
  Rat   398 YDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFSVFIDNLDTRLPRIALFSTRT 462

  Fly  1587 IDAGEEICFDYGEK-----------FWRVEHRSCVGCRCLTTTCK 1620
            |.||||:.|||..|           :.....|....|:|...||:
  Rat   463 IKAGEELTFDYQMKGSGELSSDSIDYSPARKRVRTQCKCGAETCR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744 23/129 (18%)
SET 1495..1602 CDD:214614 53/126 (42%)
Suv39h2XP_038951911.1 CD_SUV39H1_like 148..196 CDD:349289
SET_SUV39H2 268..510 CDD:380930 81/242 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352036
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753093at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.