DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and Ezh2

DIOPT Version :9

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:XP_006236463.1 Gene:Ezh2 / 312299 RGDID:1595860 Length:751 Species:Rattus norvegicus


Alignment Length:212 Identity:68/212 - (32%)
Similarity:94/212 - (44%) Gaps:34/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1399 CIIQQNSVQIDRRVS---QMRI--CSCLDSCSSDRCQCNGASSQNWYTAESRLNADFNYEDPAVI 1458
            |:|.||..:...:.|   |.|.  |.|...|::.:|.|        |.|....       ||.:.
  Rat   541 CVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPC--------YLAVREC-------DPDLC 590

  Fly  1459 FECN--DVCGCNQLSCKNRVVQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEILTA 1521
            ..|.  |......:||||..:|.|::..|.:...:  ..|||:.....|.|..|:..|.|||::.
  Rat   591 LTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSD--VAGWGIFIKDPVQKNEFISEYCGEIISQ 653

  Fly  1522 MEADRRTD------DSYYFDLDNGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKIA 1580
            .|||||..      .|:.|:|:|...:||...||..||.|||..||.. .:|...:.|:|   |.
  Rat   654 DEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCY-AKVMMVNGDHR---IG 714

  Fly  1581 FFSCRDIDAGEEICFDY 1597
            .|:.|.|..|||:.|||
  Rat   715 IFAKRAIQTGEELFFDY 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744 18/73 (25%)
SET 1495..1602 CDD:214614 43/109 (39%)
Ezh2XP_006236463.1 EZH2_WD-Binding 39..68 CDD:402972
PRC2_HTH_1 158..249 CDD:407952
preSET_CXC 564..595 CDD:408079 10/45 (22%)
SET_EZH2 614..733 CDD:380995 45/124 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.