DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and Ezh2

DIOPT Version :10

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:XP_006236463.1 Gene:Ezh2 / 312299 RGDID:1595860 Length:751 Species:Rattus norvegicus


Alignment Length:212 Identity:68/212 - (32%)
Similarity:94/212 - (44%) Gaps:34/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1399 CIIQQNSVQIDRRVS---QMRI--CSCLDSCSSDRCQCNGASSQNWYTAESRLNADFNYEDPAVI 1458
            |:|.||..:...:.|   |.|.  |.|...|::.:|.|        |.|....       ||.:.
  Rat   541 CVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPC--------YLAVREC-------DPDLC 590

  Fly  1459 FECN--DVCGCNQLSCKNRVVQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEILTA 1521
            ..|.  |......:||||..:|.|::..|.:...:  ..|||:.....|.|..|:..|.|||::.
  Rat   591 LTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSD--VAGWGIFIKDPVQKNEFISEYCGEIISQ 653

  Fly  1522 MEADRRTD------DSYYFDLDNGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKIA 1580
            .|||||..      .|:.|:|:|...:||...||..||.|||..||.. .:|...:.|:|   |.
  Rat   654 DEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCY-AKVMMVNGDHR---IG 714

  Fly  1581 FFSCRDIDAGEEICFDY 1597
            .|:.|.|..|||:.|||
  Rat   715 IFAKRAIQTGEELFFDY 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 PTZ00121 <68..>188 CDD:173412
EHMT_ZBD 786..933 CDD:411018
ANKYR 1063..1322 CDD:440430
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
SET_EHMT 1391..1622 CDD:380941 68/212 (32%)
Ezh2XP_006236463.1 EZH2_WD-Binding 39..68 CDD:463308
PRC2_HTH_1 158..249 CDD:436286
preSET_CXC 564..595 CDD:408079 10/45 (22%)
SET_EZH2 614..733 CDD:380995 45/124 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.