DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and Suv39h1l1

DIOPT Version :9

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_001100426.1 Gene:Suv39h1l1 / 302553 RGDID:1565028 Length:413 Species:Rattus norvegicus


Alignment Length:302 Identity:101/302 - (33%)
Similarity:137/302 - (45%) Gaps:68/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1364 REARPIQVVRNELAMSENEDEADSLMWP--DFRYVTQCIIQQ----NSVQIDRRVSQMRICSCLD 1422
            |..:.:...|:.|.....|:|.| |..|  .|.|:.:..:.:    |.|.:.        |.|.|
  Rat   131 RWEQELNAKRSHLGRITVENEVD-LDGPPRSFVYINEYRVGEGITLNQVAVG--------CECQD 186

  Fly  1423 S--CSSDRCQCNGASSQNWYTAESRLNADFNYEDPA--------VIFECNDVCGCNQLSCKNRVV 1477
            .  ..:..| |.|||...           |.|.|..        .|:|||..|.|. ..|.||||
  Rat   187 CLLAPTGGC-CPGASLHK-----------FAYNDQGQVRLKAGQPIYECNSRCCCG-YDCPNRVV 238

  Fly  1478 QNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEILTAMEADR------RTDDSYYFDL 1536
            |.|.|..|.|...:| .:|||||.|..:.|.:||..|.|||:|:.||:|      |...:|.|||
  Rat   239 QKGIRYNLCIFRTDD-GRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFDL 302

  Fly  1537 D---NGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKIAFFSCRDIDAGEEICFDYG 1598
            |   :.:.:||.||||::.|.||||:||:....||.::.|.|.|:||||:.|.|.||||:.|||.
  Rat   303 DYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIWAGEELTFDYN 367

  Fly  1599 EKFWRVEHRSC--------------------VGCRCLTTTCK 1620
            .:...|:..|.                    :.|:|.||.|:
  Rat   368 MQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTTACR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744 27/117 (23%)
SET 1495..1602 CDD:214614 54/115 (47%)
Suv39h1l1NP_001100426.1 Chromo 45..92 CDD:278797
PreSET 133..228 CDD:128744 26/115 (23%)
SET 244..367 CDD:214614 56/123 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753093at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.