DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and EZH1

DIOPT Version :9

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_001308008.1 Gene:EZH1 / 2145 HGNCID:3526 Length:753 Species:Homo sapiens


Alignment Length:220 Identity:68/220 - (30%)
Similarity:97/220 - (44%) Gaps:50/220 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1399 CIIQQNSVQIDRRVS---QMRI--CSCLDSCSSDRCQCNGASSQNWYTAESRLNADFNYEDPAVI 1458
            ||:.||..:...:.:   |.|.  |.|...|::.:|.|        |.|               :
Human   543 CIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPC--------YLA---------------V 584

  Fly  1459 FECN-DVC---------GCNQLSCKNRVVQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGS 1513
            .||: |:|         .|..:||||..:|.|.:..|.:...:  ..|||.....:|.|..|:..
Human   585 RECDPDLCLTCGASEHWDCKVVSCKNCSIQRGLKKHLLLAPSD--VAGWGTFIKESVQKNEFISE 647

  Fly  1514 YTGEILTAMEADRRTD------DSYYFDLDNGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQ 1572
            |.||:::..|||||..      .|:.|:|:|...:||...||..||.|||..||.. .:|...:.
Human   648 YCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCY-AKVVMVNG 711

  Fly  1573 DYRFPKIAFFSCRDIDAGEEICFDY 1597
            |:|   |..|:.|.|.||||:.|||
Human   712 DHR---IGIFAKRAIQAGEELFFDY 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744 17/81 (21%)
SET 1495..1602 CDD:214614 43/109 (39%)
EZH1NP_001308008.1 EZH2_WD-Binding 45..73 CDD:288468
SANT 439..480 CDD:238096
SANT 439..480 CDD:197842
SET <469..733 CDD:225491 66/218 (30%)
SET 619..740 CDD:214614 44/121 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158046
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.