DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and Suv39h1

DIOPT Version :9

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:XP_011245754.1 Gene:Suv39h1 / 20937 MGIID:1099440 Length:432 Species:Mus musculus


Alignment Length:259 Identity:94/259 - (36%)
Similarity:124/259 - (47%) Gaps:48/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1364 REARPIQVVRNELAMSENEDEADSLMWP--DFRYVTQCIIQQ----NSVQIDRRVSQMRICSCLD 1422
            |..:.:...|:.|.....|:|.| |..|  .|.|:.:..:.:    |.|.:.        |.|.|
Mouse   131 RWEQELNAKRSHLGRITVENEVD-LDGPPRSFVYINEYRVGEGITLNQVAVG--------CECQD 186

  Fly  1423 S--CSSDRCQCNGASSQNWYTAESRLNADFNYEDPA--------VIFECNDVCGCNQLSCKNRVV 1477
            .  ..:..| |.|||...           |.|.|..        .|:|||..|.|. ..|.||||
Mouse   187 CLLAPTGGC-CPGASLHK-----------FAYNDQGQVRLKAGQPIYECNSRCCCG-YDCPNRVV 238

  Fly  1478 QNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEILTAMEADR------RTDDSYYFDL 1536
            |.|.|..|.|....| .:|||||.|..:.|.:||..|.|||:|:.||:|      |...:|.|||
Mouse   239 QKGIRYDLCIFRTND-GRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFDL 302

  Fly  1537 D---NGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKIAFFSCRDIDAGEEICFDY 1597
            |   :.:.:||.||||::.|.||||:||:....||.::.|.|.|:||||:.|.|.||||:.|||
Mouse   303 DYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIWAGEELTFDY 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744 27/117 (23%)
SET 1495..1602 CDD:214614 54/112 (48%)
Suv39h1XP_011245754.1 CD_SUV39H1_like 44..92 CDD:349289
SET 159..372 CDD:394802 86/230 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753093at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R211
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.