DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and set-11

DIOPT Version :9

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_001364763.1 Gene:set-11 / 185242 WormBaseID:WBGene00018023 Length:278 Species:Caenorhabditis elegans


Alignment Length:281 Identity:91/281 - (32%)
Similarity:131/281 - (46%) Gaps:43/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1355 VVCADASNGREARPIQVVRNELAMSENEDEADSLMWPDFRYVTQCIIQQNSVQIDRRVSQMRICS 1419
            |:..|.|.|.|...:.|..|....      .||.::.:|:| |..||........|..|...:|.
 Worm    19 VLYEDISQGCERFVVPVYSNPRFF------MDSSLFENFKY-TSRIIDVAGQLACRSASPTFMCQ 76

  Fly  1420 CLDSCSSDRCQCN------GASSQN-----WYTAESRLNADFNYEDPAVIFECNDVCGCNQLSCK 1473
            |...||:: |:|:      |.:.:|     |.|                :.|||:.|.| .|.|.
 Worm    77 CAGQCSTN-CECSSGVFGEGGTVENMELLMWDT----------------VRECNEYCNC-ALWCG 123

  Fly  1474 NRVVQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEILTAMEADRRTDDSYYFDLDN 1538
            |||.|.|...|::|. ..|...||||||..::..|||:|.|.||::...||..|.|.::.|:...
 Worm   124 NRVAQKGAMYPVEIF-ARDPWCGWGVRASVDIAFGTFIGEYAGELIDDEEAMDRHDSTFLFETKV 187

  Fly  1539 GH---CIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKIAFFSCRDIDAGEEICFDYGEK 1600
            |.   .|||.|.||.|||.||||.|||....:.:::...:...:.||:.:.|..|||:..||||.
 Worm   188 GSETLTIDAKYSGNYTRFINHSCAPNVKVANISWDYDKIQLIHMCFFTDKAIRKGEELTIDYGEA 252

  Fly  1601 FWRVEHRSCVGCRCLTTTCKY 1621
            :|..:...|:   |.::.|:|
 Worm   253 WWANKKFPCL---CKSSECRY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744 28/119 (24%)
SET 1495..1602 CDD:214614 45/109 (41%)
set-11NP_001364763.1 PreSET 21..117 CDD:128744 28/119 (24%)
SET 75..270 CDD:394802 74/216 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165862
Domainoid 1 1.000 90 1.000 Domainoid score I4936
eggNOG 1 0.900 - - E2759_KOG1082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4686
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753093at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto17911
orthoMCL 1 0.900 - - OOG6_105922
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R211
SonicParanoid 1 1.000 - - X1720
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.630

Return to query results.
Submit another query.