DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and set-8

DIOPT Version :10

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_001359546.1 Gene:set-8 / 184086 WormBaseID:WBGene00008527 Length:407 Species:Caenorhabditis elegans


Alignment Length:158 Identity:42/158 - (26%)
Similarity:60/158 - (37%) Gaps:36/158 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1490 CED------QAKGWGVRALANVPKGTFVGSYTGEILTAMEADRRTDDSYYFDLDNGHC------- 1541
            |||      :.||:||.|...:..|..:|.|.||.::..|..||  |:.....::..|       
 Worm   250 CEDLLLKFEKNKGYGVFATKILENGCVIGQYCGEYISEKEKARR--DALAKVCNDKECKFYSFQV 312

  Fly  1542 --------------IDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKIAFFSCRDIDAGEE 1592
                          :|.:...|:|...|.|||||...:......|:.|...|...:.|.|..|||
 Worm   313 KLELLNELQAQKVYVDGSSVKNITAILNTSCEPNCTAIVEEISIQNIRIEYIVIKTKRTIKVGEE 377

  Fly  1593 ICFDYGEKFWRVEHRSCVGCRCLTTTCK 1620
            :..:|.   |    .|...|.|.:..||
 Worm   378 LTINYK---W----NSSFKCFCGSEKCK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 PTZ00121 <68..>188 CDD:173412
EHMT_ZBD 786..933 CDD:411018
ANKYR 1063..1322 CDD:440430
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
SET_EHMT 1391..1622 CDD:380941 42/158 (27%)
set-8NP_001359546.1 SET 251..389 CDD:214614 37/146 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.