DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment G9a and met-1

DIOPT Version :9

Sequence 1:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster
Sequence 2:NP_491340.2 Gene:met-1 / 172026 WormBaseID:WBGene00016603 Length:1604 Species:Caenorhabditis elegans


Alignment Length:283 Identity:77/283 - (27%)
Similarity:123/283 - (43%) Gaps:68/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1365 EARPIQVVRNELAMSENEDEA-----------DSLMWPDFRYVTQC-IIQQNSVQIDRRVSQMRI 1417
            |...||...:|  ..:.||||           :.:..|:|..:::. .:.:|:   :::.::...
 Worm   581 EEERIQKENDE--KKQKEDEAKMEEEKKKIKEEEMKIPEFELISESKYLTRNA---NKKKTESLT 640

  Fly  1418 CSCL---DSCSSDRCQCNGASSQNWYTAESRLNADFNYEDPAVIFECNDVCGCNQLSCKNRVVQN 1479
            |.|.   .:||.:.|                       .:.|::.||...|   |:.|||   |.
 Worm   641 CECHRTGGNCSDNTC-----------------------VNRAMLTECPSSC---QVKCKN---QR 676

  Fly  1480 GTRTPLQIVEC--EDQAKGWGVRALANVPKGTFVGSYTGEIL---------TAMEADRRTDDSYY 1533
            ..:.....||.  ...|||.|:||:.::.||.|:..|.||::         |...||::  ..::
 Worm   677 FAKKKYAAVEAFHTGTAKGCGLRAVKDIKKGRFIIEYIGEVVERDDYEKRKTKYAADKK--HKHH 739

  Fly  1534 FDLDNG-HCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKIAFFSCRDIDAGEEICFDY 1597
            :..|.| :.|||..|||.:||.||||:||.:..:...........::.|||.|.|.|||||.|||
 Worm   740 YLCDTGVYTIDATVYGNPSRFVNHSCDPNAICEKWSVPRTPGDVNRVGFFSKRFIKAGEEITFDY 804

  Fly  1598 GEKFWRVEH-RSCVGCRCLTTTC 1619
              :|  |.: |....|.|.:.:|
 Worm   805 --QF--VNYGRDAQQCFCGSASC 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744 19/115 (17%)
SET 1495..1602 CDD:214614 43/116 (37%)
met-1NP_491340.2 PHA03283 <219..308 CDD:223032
AWS 637..682 CDD:197795 14/73 (19%)
SET 694..810 CDD:214614 45/121 (37%)
tolA_full <1300..>1375 CDD:274303
WW 1366..1393 CDD:238122
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165870
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753093at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.