DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3038 and CG30036

DIOPT Version :10

Sequence 1:NP_569833.1 Gene:CG3038 / 30970 FlyBaseID:FBgn0040373 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster


Alignment Length:290 Identity:79/290 - (27%)
Similarity:117/290 - (40%) Gaps:79/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KRELLAVLIVTSYAGHDALRSAHRQAIPQSKLEEMG----------------------------- 117
            |.:.|.|:.|.|...|...|||.||....:|....|                             
  Fly    55 KSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLS 119

  Fly   118 ---------LRRVFLLAALPS---REHFISQDQLASEQNRFGDLLQGNFIEDYRNLSYKHVMGLK 170
                     :|.||:|....:   ||    .|:|..|..:..|::|.||::.|.||:.|.||.||
  Fly   120 GLDDSLTAKIRIVFILGRSKNDSKRE----LDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALK 180

  Fly   171 WVSEECKKQAKFIIKLDDDIIYDVFHLRRYL-----------------ETLEVREP--GLATSST 216
            .:|:.|..:|.|.:|.|||...:|.:|..:|                 .|.:|:.|  .|..|..
  Fly   181 HISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRG 245

  Fly   217 LLSGY-------VLDAKPPIRLRANKWYVSKKEYPQALYPAYLSGWLYVTNVPTAERIVAEAERM 274
            |:.|:       |.|.|.|       ||:....:..|.||.||||..|:.::...:|:.|||...
  Fly   246 LMYGHKFCNMKTVDDVKSP-------WYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTT 303

  Fly   275 SFFWIDDTWLTGVVRTRLGIPLERHNDWFS 304
            |...::|.::||:...:.|| ..||...|:
  Fly   304 SLVHLEDVFVTGICAKKAGI-RRRHQPLFN 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3038NP_569833.1 Galactosyl_T 103..297 CDD:473923 68/260 (26%)
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:473923 72/268 (27%)

Return to query results.
Submit another query.