DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STOML2 and CG33253

DIOPT Version :10

Sequence 1:NP_038470.1 Gene:STOML2 / 30968 HGNCID:14559 Length:356 Species:Homo sapiens
Sequence 2:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster


Alignment Length:62 Identity:16/62 - (25%)
Similarity:19/62 - (30%) Gaps:28/62 - (45%)


- Green bases have known domain annotations that are detailed below.


Human   663 PNLRGSGVHGGLIILEPRFTGDTLAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKRDKMA 724
            ||  .:|....||..:|.|          :|..||                ..|.||.||.|
  Fly     5 PN--STGYPANLITTQPPF----------VPSDKT----------------PGETEKEDKNA 38

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STOML2NP_038470.1 HflC 41..300 CDD:440099
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..356
CG33253NP_001259699.1 SPFH_SLP-4 112..319 CDD:259813
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.