Sequence 1: | NP_038951.1 | Gene: | Rnf19a / 30945 | MGIID: | 1353623 | Length: | 840 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245736.1 | Gene: | ari-1 / 32796 | FlyBaseID: | FBgn0017418 | Length: | 503 | Species: | Drosophila melanogaster |
Alignment Length: | 213 | Identity: | 64/213 - (30%) |
---|---|---|---|
Similarity: | 97/213 - (45%) | Gaps: | 31/213 - (14%) |
- Green bases have known domain annotations that are detailed below.
Mouse 131 ECPLCLLRHSKDRFPDIMT---CHHRSCVDCLRQYLRIEISESRV--NISCPE--CTERFNPHDI 188
Mouse 189 RLILSDDVLMEKYEEFMLRRWLVADPDCRWCPAPDCGYAV-IAFGCASCPKLTCGREGCGTEFCY 252
Mouse 253 HCKQIWHPNQTCDAARQERAQSLRLRTIRSSSISYSQESGAAADDIKPCPRCAAYIIKMNDGSCN 317
Mouse 318 HMTCAVCGC--EFCWLCM 333 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rnf19a | NP_038951.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 40..61 | ||
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 | 128..351 | 64/213 (30%) | |||
RING | 132..179 | CDD:214546 | 16/53 (30%) | ||
IBR | 199..264 | CDD:214763 | 20/65 (31%) | ||
IBR | <297..335 | CDD:279784 | 20/39 (51%) | ||
AzlC | <361..450 | CDD:294385 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 625..685 | ||||
Interaction with CASR. /evidence=ECO:0000250 | 660..840 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 700..721 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 786..808 | ||||
ari-1 | NP_001245736.1 | IBR | 204..264 | CDD:214763 | 20/64 (31%) |
IBR | <286..326 | CDD:279784 | 20/40 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1815 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |