DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HINT1 and NitFhit

DIOPT Version :10

Sequence 1:NP_005331.1 Gene:HINT1 / 3094 HGNCID:4912 Length:126 Species:Homo sapiens
Sequence 2:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster


Alignment Length:97 Identity:26/97 - (26%)
Similarity:41/97 - (42%) Gaps:16/97 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    31 IIFEDDRCLAFHDISPQAPTHFLVIPKK---HISQISVAEDDDESLLGHLMIVGKKCAADLGLNK 92
            |.:|.:.|.||.::......|.||..|:   .:..:..||..|        :....|.....|.|
  Fly   328 IFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMAD--------MFTTVCLVQRLLEK 384

Human    93 GYR-----MVVNEGSDGGQSVYHVHLHVLGGR 119
            .|:     :.|.:|:..||:|.|||.|::..|
  Fly   385 IYQTTSATVTVQDGAQAGQTVPHVHFHIMPRR 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HINT1NP_005331.1 PKCI_related 16..118 CDD:238607 25/94 (27%)
Histidine triad motif 110..114 3/3 (100%)
NitFhitNP_525122.1 nit 34..296 CDD:143596
FHIT 317..436 CDD:238606 26/97 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.