DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmcd1 and pk

DIOPT Version :9

Sequence 1:NP_659048.1 Gene:Lmcd1 / 30937 MGIID:1353635 Length:365 Species:Mus musculus
Sequence 2:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster


Alignment Length:242 Identity:84/242 - (34%)
Similarity:113/242 - (46%) Gaps:35/242 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse   118 YEWAPPGVTQKLGLQYMELIPKERQPVTGTEGALYRRRQLMHQLPIYDQDPSRCRGLVENELKAM 182
            |.|.|||:.......|...||.::.|...:.|..||.|||:||||.:|.:...|..|.:.|.|.:
  Fly   534 YTWVPPGLRPDQVRLYFSQIPDDKVPYVNSPGEQYRVRQLLHQLPPHDNEVRYCHSLTDEERKEL 598

Mouse   183 EEFVKHYKSEALGVGEVALPGQGGLPKEENKTQEKPEGTETTAPTTNGSLGDPSKEVEYVCELCK 247
            ..|....|.:|||.|.|           ......:|                        |:.|.
  Fly   599 RLFSTQRKRDALGRGNV-----------RQL
MSARP------------------------CDGCD 628

Mouse   248 GAAPVDSPVVYADRAGYSKQWHPTCFQCIKCSEPLVDLIYFWKDGAPWCGRHYCESVRPRCSGCD 312
            .........|:|.|.|.:..|||.||.|..|.|.|||||||.:||..:||||:.|:::||||.||
  Fly   629 DLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHA
ETLKPRCSACD 693

Mouse   313 EIIFSEDYQRVEDLAWHRKHFICEGCEQLLSGRAYIVTKGQLLCPTC 359
            |||.:::....|..|||..||.|..|::.|.|:.||:.:|:..|..|
  Fly   694 EIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHC 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmcd1NP_659048.1 PET_testin 116..203 CDD:193604 31/84 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..231 1/30 (3%)
LIM1_Testin_like 243..300 CDD:188726 26/56 (46%)
LIM 306..359 CDD:295319 23/52 (44%)
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 31/94 (33%)
LIM1_Prickle 624..682 CDD:188799 27/57 (47%)
LIM2_Prickle 687..742 CDD:188802 24/54 (44%)
LIM3_Prickle 747..805 CDD:188804
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422310at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.