DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2K and Ubc4

DIOPT Version :9

Sequence 1:NP_005330.1 Gene:UBE2K / 3093 HGNCID:4914 Length:200 Species:Homo sapiens
Sequence 2:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:199 Identity:136/199 - (68%)
Similarity:163/199 - (81%) Gaps:0/199 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPET 65
            |||:||.|||||||||::|||..:..||::||::::||||||||||||||||||::.||||:|||
  Fly     1 MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPET 65

Human    66 YPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVV 130
            ||||||||||||:||||||||||||||||||||.|||||||||||||||||||||||||||||||
  Fly    66 YPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVV 130

Human   131 ANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATE 195
            |.|:|...::|..||:.|.:.|||.|.:.|:...||:.|..||.|.:.....||.::|::|.|||
  Fly   131 AYQFKDKYDLFLLTAKHWTNAYAGGPHTFPDCDSKIQRLRDMGIDEHEARAVLSKENWNLEKATE 195

Human   196 LLLS 199
            .|.|
  Fly   196 GLFS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2KNP_005330.1 UBCc 6..149 CDD:238117 111/142 (78%)
UBA_II_E2_UBE2K 163..200 CDD:270573 15/37 (41%)
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 116/151 (77%)
UQ_con 8..149 CDD:278603 110/140 (79%)
UBA_II_E2_UBCD4 163..198 CDD:270574 13/34 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160465
Domainoid 1 1.000 228 1.000 Domainoid score I2501
eggNOG 1 0.900 - - E2759_KOG0418
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3903
Inparanoid 1 1.050 279 1.000 Inparanoid score I2925
Isobase 1 0.950 - 0 Normalized mean entropy S653
OMA 1 1.010 - - QHG57104
OrthoDB 1 1.010 - - D1418652at2759
OrthoFinder 1 1.000 - - FOG0003491
OrthoInspector 1 1.000 - - oto90641
orthoMCL 1 0.900 - - OOG6_103192
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4349
SonicParanoid 1 1.000 - - X2383
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.