DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snai3 and esg

DIOPT Version :9

Sequence 1:XP_006531137.1 Gene:Snai3 / 30927 MGIID:1353563 Length:327 Species:Mus musculus
Sequence 2:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster


Alignment Length:243 Identity:103/243 - (42%)
Similarity:125/243 - (51%) Gaps:55/243 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    37 LAGSRHLPDEEAPCNPS---------DPLQPWDSTSAVACISLP--LLPNHRE---TLGVSGPEP 87
            |.|..|.....||.:|:         ..:.|..|.|:    |||  |...|:.   .|..|.|..
  Fly   220 LGGYTHTHHHHAPISPAYSENSYYSMRSMTPESSCSS----SLPEDLSLKHKNLNLNLNTSQPGE 280

Mouse    88 QETSWVGPRAAQA-PSVTLKDSFTLPPLLVLPTRWPPILGPDGALNEHLRAEGTSRVPGSFECIH 151
            |..:..|..:.:. |:.:.|.....||                                .::|..
  Fly   281 QAAAKTGDMSPETMPNASAKKDKNQPP--------------------------------RYQCPD 313

Mouse   152 CHRPYHTLAGLARHQQLHCHLPTG----RAFTCRYCDKEYASLGALKMHIRTHTLPCICKVCGKA 212
            |.:.|.|.:||.:|||.||....|    ::|:|:.|||.|.||||||||||||||||.|.:||||
  Fly   314 CQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMHIRTHTLPCKCNLCGKA 378

Mouse   213 FSRPWLLQGHIRTHTGEKPYTCSHCSRAFADRSNLRAHLQTHVGTKKY 260
            |||||||||||||||||||::|.||.||||||||||||||||...|||
  Fly   379 FSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKY 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snai3XP_006531137.1 C2H2 Zn finger 149..169 CDD:275368 9/19 (47%)
C2H2 Zn finger 180..200 CDD:275368 15/19 (79%)
C2H2 Zn finger 206..226 CDD:275368 17/19 (89%)
zf-C2H2 206..226 CDD:333835 17/19 (89%)
zf-H2C2_2 219..242 CDD:372612 18/22 (82%)
zf-C2H2 232..254 CDD:333835 17/21 (81%)
C2H2 Zn finger 234..254 CDD:275368 17/19 (89%)
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 9/21 (43%)
C2H2 Zn finger 311..331 CDD:275370 9/19 (47%)
zf-C2H2 344..366 CDD:278523 16/21 (76%)
C2H2 Zn finger 346..366 CDD:275368 15/19 (79%)
zf-C2H2 370..392 CDD:278523 18/21 (86%)
C2H2 Zn finger 372..392 CDD:275368 17/19 (89%)
zf-H2C2_2 385..408 CDD:290200 18/22 (82%)
zf-C2H2 398..420 CDD:278523 17/21 (81%)
C2H2 Zn finger 400..420 CDD:275368 17/19 (89%)
C2H2 Zn finger 428..444 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11573
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8700
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X955
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.