Sequence 1: | NP_038941.1 | Gene: | Angptl3 / 30924 | MGIID: | 1353627 | Length: | 455 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723894.2 | Gene: | CG31832 / 318970 | FlyBaseID: | FBgn0051832 | Length: | 227 | Species: | Drosophila melanogaster |
Alignment Length: | 210 | Identity: | 59/210 - (28%) |
---|---|---|---|
Similarity: | 107/210 - (50%) | Gaps: | 19/210 - (9%) |
- Green bases have known domain annotations that are detailed below.
Mouse 255 HT------SGVYTIKPRNSQGFNV-YCDTQSGSPWTLIQHRKDGSQDFNETWENYEKGFGRLDGE 312
Mouse 313 FWLGLEKIYAIVQQSNYILRLELQDWKDSKHYVEY-SFHLGSHETNYTL-HVAEIAGNIPGALPE 375
Mouse 376 HTDLMFSTWNH-RAKGQLYCPESYSGGWWWNDICGENNLNGKYNKPRTKSRPERRRGIYWRPQSR 439
Mouse 440 -KLYAIKSSKMMLQP 453 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Angptl3 | NP_038941.1 | Sufficient to inhibit LIPG/EL phospholipase activity. /evidence=ECO:0000250|UniProtKB:Q9Y5C1 | 17..207 | ||
Sufficient to inhibit LPL lipase activity. /evidence=ECO:0000250|UniProtKB:Q9Y5C1, ECO:0000269|PubMed:20581395 | 17..165 | ||||
Required for inhibition of LPL lipase activity. /evidence=ECO:0000250|UniProtKB:Q9Y5C1 | 32..56 | ||||
SPEC | <34..191 | CDD:295325 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 202..242 | ||||
FReD | 241..453 | CDD:238040 | 58/208 (28%) | ||
CG31832 | NP_723894.2 | FReD | 28..225 | CDD:238040 | 57/205 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |