DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Batf2 and kay

DIOPT Version :9

Sequence 1:XP_006231015.1 Gene:Batf2 / 309178 RGDID:1311481 Length:276 Species:Rattus norvegicus
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:310 Identity:68/310 - (21%)
Similarity:113/310 - (36%) Gaps:88/310 - (28%)


- Green bases have known domain annotations that are detailed below.


  Rat    18 EESQKQLKKKQKNRLAAQRSRQKHTSKADALHQQHESLEKQNHALRKEIQALQSELARWGRTLHL 82
            ||.||:..::::|:.||.|.|::...:.:.|.::.|.|||:..::||||:.|.:...:....|..
  Fly   416 EEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLAT 480

  Rat    83 HERLCG------VGCGPCPALL-PSGCPVQAKQLSGQPAPHGYH----------GCQEQLFQTPG 130
            |...|.      :....|..|: |:|........||..:.|.::          |....|..| |
  Fly   481 HRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNST-G 544

  Rat   131 SSPRAQQLSP-----------------------------GPCYHESPGLLPFPLPSLSSDPLM-- 164
            .|.....|.|                             ||     |......||.:|:.|.:  
  Fly   545 RSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGP-----PPSKRITLPPMSTMPHVHL 604

  Rat   165 -------------VRTPLAQLSP---SPALSALSSGSSRLGSFSKFDALIPSPPDQLVSPQRLRL 213
                         ::||:...:|   ..|....|:||| :.:.:.....:.||  .|.:..::..
  Fly   605 STILTPTGASSGSLQTPITSTAPGGFGSAFPVTSNGSS-INNINSIGNNMNSP--TLNAHNKVPK 666

  Rat   214 EQPTSGRLASSDSPAALGPERPQNGEHLP---TQSGSPTHWQKSPVD-PS 259
            |:|.:           |..:||....||.   .::|.||..|..|:. ||
  Fly   667 ERPNT-----------LAFQRPLGQMHLTMANNKAGGPTQIQGVPIQTPS 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Batf2XP_006231015.1 bZIP 30..76 CDD:419672 15/45 (33%)
coiled coil 30..76 CDD:269834 15/45 (33%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 17/60 (28%)
coiled coil 421..480 CDD:269869 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.