DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesp1 and Fer1

DIOPT Version :9

Sequence 1:NP_001101001.1 Gene:Mesp1 / 308766 RGDID:1311751 Length:242 Species:Rattus norvegicus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:238 Identity:61/238 - (25%)
Similarity:95/238 - (39%) Gaps:61/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Rat    23 SMPSDGDSFCSPAWSSDSWDGAQASSPALPCARPARRAGTPGRRGTHGSRLGSGQRQSASEREKL 87
            |...|.|...|..::||..:..:...|.      :||:..| ||....|::.. |||:|:.||:.
  Fly    41 SESDDEDDAYSSGFNSDQENTEKTFCPF------SRRSHKP-RRLKCASQMAQ-QRQAANLRERR 97

  Rat    88 RMRTLARALHELRRFLPPSVAPIGQNLTKIETLRLAIRYIGHLSAVL---------GLSEDSLRQ 143
            ||:::..|...||..:|  ..|..:.|:|::||:|||.||..||.::         |||    .|
  Fly    98 RMQSINEAFEGLRTHIP--TLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLS----LQ 156

  Rat   144 QRHAVSPRGCPLCPDSGLAQAQSLGPHLSPVACSGVSW-GSSPAYPRPRVAAESWDPSF------ 201
            :.:...|....:..|.....|.||            || .....||..::.|.:|.|..      
  Fly   157 RNYQKEPPKKIILKDRTGGVAHSL------------SWYRKGDRYPGSKLYARTWTPEDPRGPHS 209

  Rat   202 ----LYTETASLERQE---------------MEPSPSSPLFSS 225
                ||..:.|.:.|.               .:|..::.:|||
  Fly   210 QPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesp1NP_001101001.1 HLH 77..130 CDD:278439 22/52 (42%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.