DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EHD3 and Dap160

DIOPT Version :10

Sequence 1:NP_055415.1 Gene:EHD3 / 30845 HGNCID:3244 Length:535 Species:Homo sapiens
Sequence 2:NP_001246118.1 Gene:Dap160 / 35378 FlyBaseID:FBgn0023388 Length:1190 Species:Drosophila melanogaster


Alignment Length:190 Identity:62/190 - (32%)
Similarity:89/190 - (46%) Gaps:16/190 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   351 GDFPNLKRMQDQLQAQDFSKFQPLKSKLLEV--VDDMLAHDIAQLMVLVRQEESQRPIQMVKGGA 413
            ||.|:   |..:......|...|||..:..|  |..::|..:|...|:      ..|...|..|.
  Fly   101 GDVPS---MTPRGSTSSLSPLDPLKGIVPAVAPVVPVVAPPVAVATVI------SPPGVSVPSGP 156

Human   414 FEGTLHGPFGH-GYGEGAG--EGIDDAEWVV-ARDKPMYDEIFYTLSPV-DGKITGANAKKEMVR 473
            ...|.:.|..| ...|.|.  |.::..||.| |..|..|.::|...... .|.:||:.|:..:|:
  Fly   157 TPPTSNPPSRHTSISERAPSIESVNQGEWAVQAAQKRKYTQVFNANDRTRSGYLTGSQARGVLVQ 221

Human   474 SKLPNSVLGKIWKLADIDKDGMLDDDEFALANHLIKVKLEGHELPNELPAHLLPPSKRKV 533
            ||||...|.:||.|:|||.||.|:.|||.||..|.:..:.|.::|..||...:||:.||:
  Fly   222 SKLPQVTLAQIWTLSDIDGDGRLNCDEFILAMFLCEKAMAGEKIPVTLPQEWVPPNLRKI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EHD3NP_055415.1 EHD_N <37..56 CDD:465295
EHD 60..300 CDD:206740
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 65..72
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 91..92
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 153..156
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01055 219..222
DUF5600 288..394 CDD:465667 12/44 (27%)
EH 438..531 CDD:197477 38/94 (40%)
Dap160NP_001246118.1 EH 7..101 CDD:197477 62/190 (33%)
EH 184..279 CDD:197477 38/94 (40%)
SMC_prok_B <368..>615 CDD:274008
SH3_Intersectin_1 674..728 CDD:212770
SH3_Intersectin_3 779..830 CDD:212772
SH3_Intersectin_4 941..998 CDD:212773
SH3_Intersectin_5 1025..1077 CDD:212774
RRM_SF <1125..1175 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.