DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NRG1 and grk

DIOPT Version :9

Sequence 1:NP_001309134.1 Gene:NRG1 / 3084 HGNCID:7997 Length:700 Species:Homo sapiens
Sequence 2:NP_476568.2 Gene:grk / 34171 FlyBaseID:FBgn0001137 Length:295 Species:Drosophila melanogaster


Alignment Length:252 Identity:56/252 - (22%)
Similarity:98/252 - (38%) Gaps:78/252 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   107 DSPTHLDPGGL--GQDPIISLDAT-------AASAVWVSSEAYTSPVSRAQSESEVQ-VTVQGDK 161
            |:..:.|.||.  ..|..|:.|..       :::..|::||:.| |::.:::.:..: ||..|  
  Fly    91 DTDPNPDSGGQLPNADDSIAADPEQDGIILGSSTDTWLASESST-PITDSETVTTPETVTHTG-- 152

Human   162 AVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEVRTPKSATQPQTTETNLQTAPKLSTST 226
                 ||                    |..||.:..|:..||    .|...||.:|..|      
  Fly   153 -----EP--------------------PPDPSSSSTPDSTTP----SPNDKETEIQMLP------ 182

Human   227 STTGTSHLVKCAEKEKT-FCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGI 290
                      |:|...| ||:|||.||....::|...:.|.|.|::.|:||.       ||....
  Fly   183 ----------CSEAYNTSFCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCA-------YKSWNG 230

Human   291 EFMEAEELYQKRV------------LTITGICIALLVVGIMCVVAYCKTKKQRKKLH 335
            :::.:....|::|            |.::.:.:....|.::..|...:.|:|:..||
  Fly   231 DYIYSPPTAQRKVRMAHIVFSFPVLLMLSSLYVLFAAVFMLRNVPDYRRKQQQLHLH 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NRG1NP_001309134.1 PHA02887 <236..279 CDD:165214 17/43 (40%)
Neuregulin 295..688 CDD:280343 9/53 (17%)
grkNP_476568.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.