DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NRG1 and Krn

DIOPT Version :9

Sequence 1:NP_001309134.1 Gene:NRG1 / 3084 HGNCID:7997 Length:700 Species:Homo sapiens
Sequence 2:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster


Alignment Length:306 Identity:63/306 - (20%)
Similarity:93/306 - (30%) Gaps:125/306 - (40%)


- Green bases have known domain annotations that are detailed below.


Human   182 SFLPSTAP------SFPSPTRNPEVRTPKSATQPQTTETNLQTAPKLSTSTSTTGTSHLVKCAEK 240
            ::||.||.      :.|.||..|       ...|...|        :||:.....|..:..|...
  Fly    16 AYLPLTAACSSRAIAKPRPTAAP-------ILPPDNVE--------ISTTPRPNVTFPIFACPPT 65

Human   241 EKT-FCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEA-EELYQKRV 303
            ... :|:|.|.||.|| :.|...|.|:|...|.|.||:       ||.:...::.. ..:..::.
  Fly    66 YVAWYCLNDGTCFTVK-IHNEILYNCECALGFMGPRCE-------YKEIDGSYLPTRNRVMLEKA 122

Human   304 LTITGICIALLVVGIMCVVAYCKTKK-QRKKLHDRLRQSLRSERNNMMNIANGPHHPNPPPENVQ 367
            ..::|..:|||.:.:.|||.|.:.:| |::||||                               
  Fly   123 SIVSGATLALLFMAMCCVVLYLRHEKLQKQKLHD------------------------------- 156

Human   368 LVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHTESILSESHSVIV 432
                                                |||.|.|.....:.|              
  Fly   157 ------------------------------------STTTTTTDGGCQNEG-------------- 171

Human   433 MSSVENSRHSSPTGGPRG------------RLNGTGGPRECNSFLR 466
            |..|:..|...|...|.|            :...:..||.||..||
  Fly   172 MDEVDGLRPLRPVRRPFGPCRILSLEEAHLQAKASNRPRHCNELLR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NRG1NP_001309134.1 PHA02887 <236..279 CDD:165214 16/43 (37%)
Neuregulin 295..688 CDD:280343 32/186 (17%)
KrnNP_524129.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40711
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5683
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.