DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POLR1H and Polr2I

DIOPT Version :10

Sequence 1:NP_055411.1 Gene:POLR1H / 30834 HGNCID:13182 Length:126 Species:Homo sapiens
Sequence 2:NP_731898.1 Gene:Polr2I / 41741 FlyBaseID:FBgn0004855 Length:129 Species:Drosophila melanogaster


Alignment Length:122 Identity:27/122 - (22%)
Similarity:51/122 - (41%) Gaps:10/122 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     2 SVMDLANTCSSFQSDLDFCSDCGSVL-PLPGAQDTV---TCIRCGFNINVRDFEGKVVKTSVVFH 62
            :..|.|:|.......:.||.:|.::| |....::.:   .|..|.:.   ::.:...:..:.:.|
  Fly     3 TAFDAAHTEGPGFVGIRFCQECNNMLYPKEDKENKILLYACRNCDYK---QEADSNCIYVNKIMH 64

Human    63 QLG--TAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTN 117
            ::.  |.:...|...|... ...|..||:|.|....:...|.|.|:|...::|.|||
  Fly    65 EIDELTHIVPDVISDPTLP-RTEDHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTN 120

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
POLR1HNP_055411.1 RPB9 19..118 CDD:441202 24/105 (23%)
Zn-ribbon_RPA12 79..125 CDD:259792 13/39 (33%)