DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POLR1H and Polr3K

DIOPT Version :10

Sequence 1:NP_055411.1 Gene:POLR1H / 30834 HGNCID:13182 Length:126 Species:Homo sapiens
Sequence 2:NP_001027443.1 Gene:Polr3K / 3772344 FlyBaseID:FBgn0061362 Length:108 Species:Drosophila melanogaster


Alignment Length:112 Identity:36/112 - (32%)
Similarity:48/112 - (42%) Gaps:25/112 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    17 LDFCSDCGSVLPLPGAQDT----VTCIRCGFNINVRDFEGKVVKTSV------VFHQL-GTAMPM 70
            |.||..||::|.:  .:||    .||..|.:...:|    :.:.|..      |.|.| |.|...
  Fly     2 LFFCPSCGNILII--EEDTNCHRFTCNTCPYISKIR----RKISTKTFPRLKEVDHVLGGKAAWE 60

Human    71 SVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTN 117
            :|:.        .|..||.|||:...:...|.|||||..|.||.|.|
  Fly    61 NVDS--------TDAECPTCGHKRAYFMQIQTRSADEPMTTFYKCCN 99

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
POLR1HNP_055411.1 RPB9 19..118 CDD:441202 35/110 (32%)
Zn-ribbon_RPA12 79..125 CDD:259792 17/39 (44%)