DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POLR1H and CG8117

DIOPT Version :10

Sequence 1:NP_055411.1 Gene:POLR1H / 30834 HGNCID:13182 Length:126 Species:Homo sapiens
Sequence 2:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster


Alignment Length:74 Identity:16/74 - (21%)
Similarity:27/74 - (36%) Gaps:14/74 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    46 NVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDR-RCPRCGHEGMAYHTRQMRSADEGQ 109
            :::....|.|:.|:...|:.           :.||...|: :|.||.....:  ...:|..||..
  Fly    96 DMKQMRQKYVQDSINAAQMA-----------KVQGTKTDQFKCERCDKRNCS--QLHIRDGDEPI 147

Human   110 TVFYTCTNC 118
            ..|..|..|
  Fly   148 ITFVICDEC 156

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
POLR1HNP_055411.1 RPB9 19..118 CDD:441202 15/72 (21%)
Zn-ribbon_RPA12 79..125 CDD:259792 12/41 (29%)