DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSX1 and PHDP

DIOPT Version :10

Sequence 1:NP_055403.2 Gene:VSX1 / 30813 HGNCID:12723 Length:365 Species:Homo sapiens
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:64 Identity:41/64 - (64%)
Similarity:50/64 - (78%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   161 KRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREK 224
            |.|:||.||.||::||.||||.|.|.||||:|.||.:|.|..|.|.|:||||||||||:||:|:
  Fly   109 KSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQER 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSX1NP_055403.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Octapeptide motif 31..38
PRK14959 <47..>149 CDD:184923
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..167 3/5 (60%)
Nuclear localization signal. /evidence=ECO:0000255 161..166 2/4 (50%)
Homeodomain 165..221 CDD:459649 36/55 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..365
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 36/55 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.