DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSX1 and CG9876

DIOPT Version :10

Sequence 1:NP_055403.2 Gene:VSX1 / 30813 HGNCID:12723 Length:365 Species:Homo sapiens
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:120 Identity:47/120 - (39%)
Similarity:59/120 - (49%) Gaps:21/120 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   113 GPEPAAPLAPSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRKKRRHRTVFTAHQLE 177
            ||..|......||.|..|                     :|.|......||.||:||.|::.||.
  Fly    87 GPTGAGCGGADRPAPCSG---------------------NLPAGGGHHSRKPRRNRTTFSSAQLT 130

Human   178 ELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVM 232
            .|||.|...||||.:.||.||.|..|.|.|:||||||||||:|:.|:..|..:::
  Fly   131 ALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSVGSRTLL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSX1NP_055403.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Octapeptide motif 31..38
PRK14959 <47..>149 CDD:184923 7/35 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..167 12/53 (23%)
Nuclear localization signal. /evidence=ECO:0000255 161..166 2/4 (50%)
Homeodomain 165..221 CDD:459649 33/55 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..365
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 33/55 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.