DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adamts8 and nolo

DIOPT Version :9

Sequence 1:NP_038934.2 Gene:Adamts8 / 30806 MGIID:1353468 Length:905 Species:Mus musculus
Sequence 2:NP_001036374.1 Gene:nolo / 35424 FlyBaseID:FBgn0051619 Length:1394 Species:Drosophila melanogaster


Alignment Length:393 Identity:113/393 - (28%)
Similarity:155/393 - (39%) Gaps:82/393 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse   543 GDWGPWRPWGQCSRTCGGGIQFSNRECDNPMPQNGGRFCLGERVKYQSCNTEECPPNGKSFREQQ 607
            |.|..|..|..|||||.|||....|.|.:|    |.  |.||..:|:.||.:.||.. :.||..|
  Fly    76 GQWSSWSDWSTCSRTCDGGIMHQMRRCGSP----GS--CRGESTRYRICNMQPCPEQ-QDFRSSQ 133

Mouse   608 CEKYNAYNHTDLDGNFLQWVPKYSGVSPRDRCKLFCRAR--------------GRSE-------- 650
            |   :|||....||...:|.|.|..|.|   |.|.||..              |.:|        
  Fly   134 C---SAYNDVPYDGTLYKWTPHYDYVEP---CALTCRGHPAHLVEDISRETGDGNAEEAEHYDEQ 192

Mouse   651 --FKVFEAKVIDGTLCGPDTLSICVRGQCVKAGCDHVVNSPKKLDKCGVCGGKGTACRK--ISGS 711
              .....|:|.|||.|...:|.:|::|:|.:.|||..:.|.||:|.||||||.|.:|.:  .:..
  Fly   193 SVIVQLSARVQDGTRCRSGSLDMCIQGKCQRVGCDLKIGSTKKIDGCGVCGGDGNSCSQPLFNWE 257

Mouse   712 FTPFSYGYNDIVTIPAGATNIDVKQRSHPGVRNDGSYLALKTANGQYLLNGNLAISAIEQDILVK 776
            ..|.|   ...||..:|      .:.|.|..||             .|.|.::      .|.|..
  Fly   258 MAPMS---QCSVTCGSG------YKMSRPICRN-------------RLTNADV------DDTLCS 294

Mouse   777 GTILKYSGSMATLERLQSFQALPEPLTVQLLTVS---GEVFPPKVRYTFFVPNDMDFSVQNSKER 838
            .|    :...|::|:..:....|..:.....|.|   |..:..::.......|.:...|.:...|
  Fly   295 VT----NRPEASVEQCNTHSCPPRWIADDWSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMCR 355

Mouse   839 A------TTNIIQSLPSAEWVLGDWSECPSTCRGSWQRRTVECRDPSGQASDTCDEALKPEDAKP 897
            .      .|.||:..|  .|.:.||:.|..:|....|.|.|||:...|..|..||...||...:.
  Fly   356 TPKPPTQETCIIEECP--HWEVEDWTGCSVSCGQGIQMRGVECKSTDGSLSAKCDPLTKPGSMQQ 418

Mouse   898 CGS 900
            |.:
  Fly   419 CST 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adamts8NP_038934.2 Pep_M12B_propep 52..152 CDD:279848
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..163
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..225
Reprolysin 234..444 CDD:279729
ZnMc_ADAMTS_like 234..441 CDD:239801
ADAM_CR 463..529 CDD:301627
TSP1 545..597 CDD:214559 21/51 (41%)
Spacer 706..847 26/151 (17%)
ADAM_spacer1 706..825 CDD:283607 20/123 (16%)
TSP1 852..904 CDD:214559 17/49 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 877..905 7/24 (29%)
noloNP_001036374.1 TSP1 78..124 CDD:214559 21/51 (41%)
TSP1 546..600 CDD:214559
TSP1 750..807 CDD:214559
IGc2 845..902 CDD:197706
PLAC 1355..1384 CDD:285849
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.