DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tal1 and CG33557

DIOPT Version :10

Sequence 1:NP_998402.1 Gene:tal1 / 30766 ZFINID:ZDB-GENE-980526-501 Length:324 Species:Danio rerio
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:96 Identity:41/96 - (42%)
Similarity:52/96 - (54%) Gaps:11/96 - (11%)


- Green bases have known domain annotations that are detailed below.


Zfish   148 SGFAGDAE--QYGMYPSNRVKRRPAPYEVEINDGSQPKIVRRIFTNSRERWRQQNVNGAFAELRK 210
            ||.|.|:|  |.|.      :..|...|   |.|:..:...|...|:|||:|..|||.|:..||.
  Fly    31 SGAAADSEDSQIGQ------EANPGGQE---NQGNHRRRPPRQKINARERYRTFNVNSAYEALRN 86

Zfish   211 LIPTHPPDKKLSKNEILRLAMKYINFLAKLL 241
            ||||.|.::||||.||:|||..||..|:..|
  Fly    87 LIPTEPMNRKLSKIEIIRLASSYITHLSSTL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tal1NP_998402.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
bHLH_TS_TAL1 183..247 CDD:381549 30/59 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..324
CG33557NP_001014730.1 bHLH_TS_scleraxis_like 63..117 CDD:381471 29/53 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.