DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppardb and Hr96

DIOPT Version :9

Sequence 1:NP_571543.1 Gene:ppardb / 30754 ZFINID:ZDB-GENE-000112-47 Length:517 Species:Danio rerio
Sequence 2:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster


Alignment Length:448 Identity:99/448 - (22%)
Similarity:159/448 - (35%) Gaps:112/448 - (25%)


- Green bases have known domain annotations that are detailed below.


Zfish   152 CRICGDKASGFHYGVHACEGCKGFFRRTIRMKLEYERC--ERACKVQKKSRNKCQYCRFQKCLAL 214
            |.:|||||.|:::....||.||.||||....|.:: .|  .:.|.:...:|..||.||.:|||.:
  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQF-TCPFNQNCDITVVTRRFCQKCRLRKCLDI 70

Zfish   215 GMSHDAIRYGRMPEAEKKKLV---------AGLLAGENPQSSSGADLKTLAKHVNTAYLRNLNM- 269
            ||..:.|.      :|:.||:         |.....||...:..||......|...|...:.|: 
  Fly    71 GMKSENIM------SEEDKLIKRRKIETNRAKRR
LMENGTDACDADGGEERDHKAPADSSSSNLD 129

Zfish   270 ------TKKKARSILTGKTSCTA-----------PF----------VIHDMDSLWQAENGLVWNQ 307
                  ..:...|..:|...|:.           |.          ::.|.|...||.|.|:..|
  Fly   130 HYSGSQDSQSCGSADSGANGCSGRQASSPGTQVNPLQMTAEKIVDQIVSDPDRASQAINRLMRTQ 194

Zfish   308 LNGAPLNKEIGVHVFYRCQCTTVETVRELTEFAKNIPGFVDLFLNDQVTLLKYGVHEAIFAMLPS 372
            .....:.:::     ...|...:..|..|.::..:....:..|:|.....|      .:|....|
  Fly   195 KEAISVMEKV-----ISSQKDALRLVSHLIDYPGDALKIISKFMNSPFNAL------TVFTKFMS 248

Zfish   373 LMNKDGL-----LVANGKGFVTREFLRSL-RKPFSEIMEPKFEFAVKFNALELDDSDLALFVAAI 431
             ...||:     :|.:....|  ||:::| ..|     |...:...||    ::....||.:...
  Fly   249 -SPTDGVEIISKIVDSPADVV--EFMQNLMHSP-----EDAIDIMNKF----MNTPAEALRILNR 301

Zfish   432 ILCG----------DRPGLMN----VKQVEQIQ--DGILQA-------LDQH-----LQVHHP-- 466
            ||.|          ||..|::    ||.....:  |.::|:       :..|     ||.|.|  
  Fly   302 ILSGGGANAAQQTADRKPLLDKEPAVKPAAPAERADTVIQSMLGNSPPISPHDAAVDLQYHSPGV 366

Zfish   467 ------DSSHLFPKLLQKM-ADLRQLVTENAQLVQMIKKTESETSLHPLLQEIYKDMY 517
                  .|||..|.:.... .||:..:..|......:....|..|:..:|.|:.:..|
  Fly   367 GEQPSTSSSHPLPYIANSPDFDLKTFMQTNYNDEPSLDSDFSINSIESVLSEVIRIEY 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppardbNP_571543.1 NR_DBD_Ppar 151..234 CDD:143523 30/83 (36%)
NR_LBD_PPAR 250..516 CDD:132730 63/336 (19%)
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 33/97 (34%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.