DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tie1 and drpr

DIOPT Version :9

Sequence 1:XP_001334673.5 Gene:tie1 / 30746 ZFINID:ZDB-GENE-990415-55 Length:1122 Species:Danio rerio
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:349 Identity:95/349 - (27%)
Similarity:131/349 - (37%) Gaps:97/349 - (27%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MLRLICILFLVNLSDAVMDLTMTSNGATSANHFHLSCISGERDTDGIQLSIKKDNSIVLRADTPS 65
            ||.:|.|..|..|..|..||                     :|.||..:..:::          .
  Fly     1 MLPVILIACLAQLVLAQADL---------------------KDLDGPNICKRRE----------L 34

Zfish    66 FNLQRPQTKEVVATGFTGFDHSGIFYCHSKRGSDQLGNVTL---INNYSKGHFKPVRVTMTVSKG 127
            :|:      :||.|....|...|..:|           ||.   .:.|...| :.|..|.|::|.
  Fly    35 YNV------DVVYTELQSFQERGSTWC-----------VTFPPRCSTYRIKH-RVVNKTKTIAKN 81

Zfish   128 ENVHLIMDVLGTERRDIAWKFNGNYYYMTPIAD---VENRTAVLDLKKVDESYAGIYSASYVGDS 189
            ..|           ||....:..:.....|...   ...|....:..|.|..|.|  .|..:   
  Fly    82 RIV-----------RDCCDGYIASAGECVPHCSEPCQHGRCISPEKCKCDHGYGG--PACDI--- 130

Zfish   190 ALYSAWMRLIVRDCPKNKWGSDCDKECPECLNGGVCHDKNGDCVCPPGFMGMRCETACREGMFGR 254
                        :||...:|.:|..:| :|||..||...:|||.|..|:.|.||...|.||.||.
  Fly   131 ------------NCPPGWYGRNCSMQC-DCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGA 182

Zfish   255 NCQESCKPENG--CQGLSFCLTDPYG-CSCASGWHGDRCRKPCLEGMYGADCLLSCNCKNKGKCN 316
            ||.|.|:.|||  |..:|       | |.||.|:.|..|...|.:|.:||.|...|.|:|.|||.
  Fly   183 NCSEKCRCENGGKCHHVS-------GECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQ 240

Zfish   317 RFSG-CQCSTGWRGQYCEKSDRAP 339
            ..:| |.|:.||.|..|  :::.|
  Fly   241 PETGACMCNPGWTGDVC--ANKCP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tie1XP_001334673.5 EGF_CA <219..244 CDD:238011 12/24 (50%)
IG_like 346..431 CDD:214653
fn3 <461..508 CDD:278470
fn3 538..616 CDD:278470
FN3 628..720 CDD:238020
PKc_like 820..1116 CDD:304357
Pkinase_Tyr 823..1091 CDD:285015
drprNP_001261276.1 EMI 27..92 CDD:284877 18/103 (17%)
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.