DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eif4e1b and eIF4E1

DIOPT Version :9

Sequence 1:NP_571529.1 Gene:eif4e1b / 30738 ZFINID:ZDB-GENE-980526-127 Length:214 Species:Danio rerio
Sequence 2:NP_001261626.1 Gene:eIF4E1 / 45525 FlyBaseID:FBgn0015218 Length:259 Species:Drosophila melanogaster


Alignment Length:186 Identity:95/186 - (51%)
Similarity:124/186 - (66%) Gaps:2/186 - (1%)


- Green bases have known domain annotations that are detailed below.


Zfish    29 EPCMKHPLQNRWGLWFYKNDKSKMWQDNLRLITKFDTVEDFWGLYNNIQLPSKLSSGCDYSMFKD 93
            |...||||.|.|.||:.:||:||.|:|....||.||||||||.|||:|:.||::..|.|||:||.
  Fly    76 EHLYKHPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKK 140

Zfish    94 GIEPMWEDRSNKCGGRWLITLAKQHRHTELDHFWLETLLCLIGEGFSSFSRDICGSVINIRAKGD 158
            .|.|||||.:||.||||:|||.|..: |:||:.||:.|||||||.| ..|..|||:|||||.|.:
  Fly   141 NIRPMWEDAANKQGGRWVITLNKSSK-TDLDNLWLDVLLCLIGEAF-DHSDQICGAVINIRGKSN 203

Zfish   159 KIALWTSNAENCETVTYIGRKYKESLGLPQKLVIGYQAHADTATKSNSITKNKFVV 214
            ||::||::..|.|....||.|.:::|.|.:...:.||.|.||..|..|..|:.:.:
  Fly   204 KISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL 259

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eif4e1bNP_571529.1 IF4E 38..194 CDD:279921 82/155 (53%)