DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eif4e1b and eIF4E4

DIOPT Version :9

Sequence 1:NP_571529.1 Gene:eif4e1b / 30738 ZFINID:ZDB-GENE-980526-127 Length:214 Species:Danio rerio
Sequence 2:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster


Alignment Length:183 Identity:90/183 - (49%)
Similarity:123/183 - (67%) Gaps:3/183 - (1%)


- Green bases have known domain annotations that are detailed below.


Zfish    32 MKHPLQNRWGLWFYKNDKSKMWQDNLRLITKFDTVEDFWGLYNNIQLPSKLSSGCDYSMFKDGIE 96
            :||||:|.|.||:.:||:||.|:|....||.||.|||||.|||:|:.||::..|.|||:||.||:
  Fly    50 LKHPLENTWTLWYLENDRSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQ 114

Zfish    97 PMWEDRSNKCGGRWLITLAKQHRHTELDHFWLETLLCLIGEGFSSFSRDICGSVINIRAKGDKIA 161
            |||||.:||.||||:|.:.:..: .|||..||:.||.||||.|.: :.::||:|||:|.|.:||:
  Fly   115 PMWEDDANKFGGRWVINMGRGSK-AELDKLWLDVLLILIGEAFEN-TEEVCGAVINLRGKSNKIS 177

Zfish   162 LWTSNAENCETVTYIGRKYKESLGLPQKLVIGYQAHADTATKSNSITKNKFVV 214
            :||:|..|...|..||.|.::.|.||.. .:.||.|.||..|..|:.|..:.|
  Fly   178 IWTANGHNELAVMEIGLKLRDLLVLPPH-QLQYQLHKDTMCKQGSVIKAVYCV 229

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eif4e1bNP_571529.1 IF4E 38..194 CDD:279921 77/155 (50%)