DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eif4e1b and eIF4EHP

DIOPT Version :9

Sequence 1:NP_571529.1 Gene:eif4e1b / 30738 ZFINID:ZDB-GENE-980526-127 Length:214 Species:Danio rerio
Sequence 2:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster


Alignment Length:180 Identity:50/180 - (27%)
Similarity:86/180 - (47%) Gaps:28/180 - (15%)


- Green bases have known domain annotations that are detailed below.


Zfish     9 IDKVPKKKVEKKKFEPNILKE---------------PCMKHP----LQNRWGLWFYKNDKSKMWQ 54
            ::||..|:.|.|.: |:|:..               |....|    ||:.:.|||.:.:..:...
  Fly     3 MEKVANKQYETKNW-PDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQHTYCLWFSRKETQRAAA 66

Zfish    55 D---NLRLITKFDTVEDFWGLYNNIQLPSKLSSGCDYSMFKDGIEPMWEDRSNKCGGRWLITLAK 116
            |   :|.::.:..:|:.:|.||:::..|:.|....:..:||.||.|||||.:|..||:|||.|  
  Fly    67 DYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRL-- 129

Zfish   117 QHRHTELDHFWLETLLCLIGEGFSSFSRDICGSVINIRAKGDKIALWTSN 166
              |..::|..|....:.::||.| ....:|||.|:..:.....|.:..|:
  Fly   130 --RKNKVDRAWENVCMAMLGEQF-LVGDEICGVVLQTKYPNPSIQVACSS 176

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eif4e1bNP_571529.1 IF4E 38..194 CDD:279921 39/132 (30%)