DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elavl3 and Rbp9

DIOPT Version :9

Sequence 1:XP_009298008.1 Gene:elavl3 / 30732 ZFINID:ZDB-GENE-980526-76 Length:366 Species:Danio rerio
Sequence 2:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster


Alignment Length:365 Identity:214/365 - (58%)
Similarity:258/365 - (70%) Gaps:29/365 - (7%)


- Green bases have known domain annotations that are detailed below.


Zfish    13 SNGPSGTSLPNGPVISTNGATDDSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQ 77
            :|..:..:..|....:.|....|.|||||||||||.|:|:|.:|||.|.||:|||||:|||:|||
  Fly    85 NNNTNNNNNNNATANNNNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQ 149

Zfish    78 SLGYGFVNYVDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKDMEQ 142
            ||||||||||...||:||||.||||:||.||||||.|||||.||:.||||||||||.|:|.|:|.
  Fly   150 SLGYGFVNYVKQEDAEKAINALNGLRLQNKTIKVSIARPSSESIKGANLYVSGLPKNMTQSDLES 214

Zfish   143 LFSQYGRIITSRILVDQVTAGISRGVGFIRFDKRNEAEEAIKGLNGQKPLGAAEPITVKFANNPS 207
            |||.||:|||||||.|.:| |:|:||||||||:|.||:.|||.|||..|..:.||||||||||||
  Fly   215 LFSPYGKIITSRILCDNIT-GLSKGVGFIRFDQRFEADRAIKELNGTTPKNSTEPITVKFANNPS 278

Zfish   208 QKTGQALLTQLYQTAARRYTGPLHHQTQRFRLDNLLNASYGVKSSL-------------SVLPRF 259
            ...     ..:...||  |..|   |..|.......||:.|..::.             ||:.|:
  Fly   279 SNK-----NSMQPLAA--YIAP---QNTRGGRAFPANAAAGAAAAAAAAAIHPNAGRYSSVISRY 333

Zfish   260 SPITIDSMTSLAGVNLTGPT--GAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNK 322
            ||:|.|.:|:  |: :.|.|  .:|||||||||:|:.:|:||||||||||||.:||||||..:||
  Fly   334 SPLTSDLITN--GM-IQGNTIASSGWCIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNK 395

Zfish   323 CKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTSK 362
            ||||||||||||:||.:||.|||||.||:|||||||||:|
  Fly   396 CKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSFKTNK 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavl3XP_009298008.1 ELAV_HUD_SF 35..365 CDD:273741 211/343 (62%)
RRM1_Hu 37..114 CDD:241094 59/76 (78%)
RRM_SF 119..209 CDD:302621 62/89 (70%)
RRM3_HuC 282..366 CDD:241099 64/81 (79%)
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 211/343 (62%)
RRM1_Hu 109..186 CDD:241094 59/76 (78%)
RRM2_Hu 196..274 CDD:241096 54/78 (69%)
RRM3_Hu 355..432 CDD:240823 60/76 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5514
eggNOG 1 0.900 - - E1_KOG0145
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 414 1.000 Inparanoid score I1806
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm6531
orthoMCL 1 0.900 - - OOG6_103306
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.