DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdx1 and Antp

DIOPT Version :9

Sequence 1:NP_571518.2 Gene:pdx1 / 30721 ZFINID:ZDB-GENE-990415-122 Length:246 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:221 Identity:69/221 - (31%)
Similarity:91/221 - (41%) Gaps:75/221 - (33%)


- Green bases have known domain annotations that are detailed below.


Zfish    33 PPCLYMRQAHSVYA------------SPLGAQD--QPNLTDI--TSYNMSSRDDLAG-------- 73
            ||.:.....|.:.|            :.||..|  .|::|::  ..:||......:|        
  Fly   180 PPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPP 244

Zfish    74 -----------------PHLHLPQTSQTSLQSLGGYGDSLDLCGDRNRYHLP---FPWMKSTKSH 118
                             |..|.|.:...:.||.|                :|   :|||:|    
  Fly   245 QGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSG----------------MPSPLYPWMRS---- 289

Zfish   119 THAWKGQWTGPYMVEAEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELALTLSLTERHIKI 183
                       ...:.:|.||.|..|||.|.|||||||.||:|::|.||:|:|..|.||||.|||
  Fly   290 -----------QFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKI 343

Zfish   184 WFQNRRMKWKKEEDKRRARGVDPEQD 209
            ||||||||||||...:...|...|.|
  Fly   344 WFQNRRMKWKKENKTKGEPGSGGEGD 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdx1NP_571518.2 Homeobox 140..193 CDD:278475 36/52 (69%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 28/156 (18%)
Homeobox 301..354 CDD:395001 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.