Sequence 1: | NP_571518.2 | Gene: | pdx1 / 30721 | ZFINID: | ZDB-GENE-990415-122 | Length: | 246 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001368995.1 | Gene: | Scr / 40833 | FlyBaseID: | FBgn0003339 | Length: | 564 | Species: | Drosophila melanogaster |
Alignment Length: | 306 | Identity: | 88/306 - (28%) |
---|---|---|---|
Similarity: | 114/306 - (37%) | Gaps: | 128/306 - (41%) |
- Green bases have known domain annotations that are detailed below.
Zfish 8 YP--PNHLYKDSCAF--QRHPN-EDYSQNPPPCLYM-------RQAHSVYASPLGAQDQPNLTD- 59
Zfish 60 ----------------------IT-------------------------SYNMSSRDDLA----G 73
Zfish 74 PHLHLPQTSQTSLQSL--GGYGDSL----DLCGDRNRY----------------HLP-------- 108
Zfish 109 -----------------------FPWMKSTKSHTHAWKGQWTGPYMVEAE-ENKRTRTAYTRAQL 149
Zfish 150 LELEKEFLFNKYISRPRRVELALTLSLTERHIKIWFQNRRMKWKKE 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pdx1 | NP_571518.2 | Homeobox | 140..193 | CDD:278475 | 37/52 (71%) |
Scr | NP_001368995.1 | Homeobox | 328..381 | CDD:395001 | 38/52 (73%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |