DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdx1 and Scr

DIOPT Version :9

Sequence 1:NP_571518.2 Gene:pdx1 / 30721 ZFINID:ZDB-GENE-990415-122 Length:246 Species:Danio rerio
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:306 Identity:88/306 - (28%)
Similarity:114/306 - (37%) Gaps:128/306 - (41%)


- Green bases have known domain annotations that are detailed below.


Zfish     8 YP--PNHLYKDSCAF--QRHPN-EDYSQNPPPCLYM-------RQAHSVYASPLGAQDQPNLTD- 59
            ||  |...|.:..|:  |.:|: .||:|..|..|.:       :|.|:..|:.:.||.|..|.. 
  Fly    87 YPNTPQAHYANQAAYGGQGNPDMVDYTQLQPQRLLLQQQQQQQQQQHAHAAAAVAAQQQQQLAQQ 151

Zfish    60 ----------------------IT-------------------------SYNMSSRDDLA----G 73
                                  :|                         |.:::|..||:    .
  Fly   152 QHPQQQQQQQQANISCKYANDPVTPGGSGGGGVSGSNNNNNSANSNNNNSQSLASPQDLSTRDIS 216

Zfish    74 PHLHLPQTSQTSLQSL--GGYGDSL----DLCGDRNRY----------------HLP-------- 108
            |.|......::..:||  |..|.||    ...|..|.:                |.|        
  Fly   217 PKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSE 281

Zfish   109 -----------------------FPWMKSTKSHTHAWKGQWTGPYMVEAE-ENKRTRTAYTRAQL 149
                                   :||||    ..|      .|...|.|. |.||.||:|||.|.
  Fly   282 SDSGNEAGSSQNSGNGKKNPPQIYPWMK----RVH------LGTSTVNANGETKRQRTSYTRYQT 336

Zfish   150 LELEKEFLFNKYISRPRRVELALTLSLTERHIKIWFQNRRMKWKKE 195
            |||||||.||:|::|.||:|:|..|.||||.|||||||||||||||
  Fly   337 LELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdx1NP_571518.2 Homeobox 140..193 CDD:278475 37/52 (71%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.