DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lef1 and Sox15

DIOPT Version :9

Sequence 1:NP_571501.1 Gene:lef1 / 30701 ZFINID:ZDB-GENE-990714-26 Length:365 Species:Danio rerio
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:346 Identity:78/346 - (22%)
Similarity:128/346 - (36%) Gaps:103/346 - (29%)


- Green bases have known domain annotations that are detailed below.


Zfish    80 SYHEKHRDH----------PDDGKLQDL-YSKGHPYPSYPGYI----MMTNMNNEP---YMNNG- 125
            ||..:|..|          |...:..:. :|.|..||.:.||:    :|...|::.   ::..| 
  Fly     4 SYDHEHPHHLLTNYNSKKYPHVSRTPEYSHSTGSDYPEHGGYLTDGRLMHESNSDAGIYHVRQGS 68

Zfish   126 -----SLSPPIPRTS-------NKVPVVQPSHAVHPLTPLITYSDEHFAPGPHSGHHPQDVNPKQ 178
                 ||..|..::|       |:..:...||:..|: |::  |..:...|..||.......|..
  Fly    69 EHSSPSLHSPAIQSSGYENEHLNEAVLAAHSHSHSPM-PMV--SSAYVGGGTASGSLINSNIPLL 130

Zfish   179 AGMPRHHPGPDIPNFYPLSP------GGVGQM------------------------TPPLGWFSH 213
            .|     .|..:.|.:...|      ||.|||                        .|..|:...
  Fly   131 GG-----GGNSVLNKFLSHPHAGMVGGGTGQMEDCTSHSPIEAASMWSYDYKGDLCAPNCGYLER 190

Zfish   214 HMVPGPPGPHATGIPHPAIVNPQVKQEHDTDLMHMKPQHEQRKEQEPKRPHIKKPLNAFMLYMKE 278
            |.            |.||            ||.: :|...|.|..:..|  |::|:||||::.|.
  Fly   191 HK------------PLPA------------DLKY-RPGGTQSKSAKESR--IRRPMNAFMVWAKI 228

Zfish   279 MRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKK 343
            .|..:..|.....:|.::::||::|.:|:.:::..|.|.|.:.|.:||..:|.:..|....|:.|
  Fly   229 ERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQSK 293

Zfish   344 -------RKREKIQEPASGTG 357
                   .|.:....|..|||
  Fly   294 LRAMQPGGKEQSESSPNPGTG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lef1NP_571501.1 CTNNB1_binding 1..210 CDD:285538 38/190 (20%)
SOX-TCF_HMG-box 264..335 CDD:238684 21/70 (30%)
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5417
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.