DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nkx2.2a and bap

DIOPT Version :9

Sequence 1:NP_001295569.1 Gene:nkx2.2a / 30697 ZFINID:ZDB-GENE-980526-403 Length:273 Species:Danio rerio
Sequence 2:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster


Alignment Length:260 Identity:88/260 - (33%)
Similarity:119/260 - (45%) Gaps:74/260 - (28%)


- Green bases have known domain annotations that are detailed below.


Zfish     6 SLTNTKTGFSVKDIL--------------------DLPDTNDEEGSIT----------GTEEDTE 40
            |||   |.||:.|||                    .|..::|.|.||:          |..:.|:
  Fly    19 SLT---TPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQ 80

Zfish    41 GSEATKTPGVLVQSPLENVQNLPLKNPFY----DNSDNPYTRWLATTDS---------IQYSLHG 92
            ..|...:    .:.|...:|       :|    || :|.:.:...|::|         :.|....
  Fly    81 PKEIQPS----ARQPSNYLQ-------YYAAAMDN-NNHHHQATGTSNSSAADYMQRKLAYFGST 133

Zfish    93 LSA-------NSQDTSAKSPEP---SADESPDNDKETSSNGSDSGKKRKRRVLFSKAQTYELERR 147
            |:|       .|.|:...||.|   |..|||     .|.:||...:|::.|..||.||.:|||||
  Fly   134 LAAPLDMRRCTSNDSDCDSPPPLSSSPSESP-----LSHDGSGLSRKKRSRAAFSHAQVFELERR 193

Zfish   148 FRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVAVPVLVRD 212
            |.||||||.|||..:|..:|||.|||||||||.|||.||.:.:: .|...|.:.:||.|.||||:
  Fly   194 FAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQ-HEAALLGASKRVPVQVLVRE 257

Zfish   213  212
              Fly   258  257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nkx2.2aNP_001295569.1 COG5576 93..218 CDD:227863 62/130 (48%)
Homeobox 132..185 CDD:278475 36/52 (69%)
bapNP_732637.1 Homeobox 178..231 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450160at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.