DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gdf7 and scw

DIOPT Version :9

Sequence 1:XP_694563.2 Gene:gdf7 / 30642 ZFINID:ZDB-GENE-990714-1 Length:422 Species:Danio rerio
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:400 Identity:96/400 - (24%)
Similarity:161/400 - (40%) Gaps:86/400 - (21%)


- Green bases have known domain annotations that are detailed below.


Zfish    54 RNESTSVH--VPSYMISLYRTLSELDRRTGNGSHTRSRR-----------------YANTVTSFM 99
            |....::|  ...:::.:|..:|| |:......|.|.:|                 ..|::.:|.
  Fly    54 RQAEPNLHNSASKFLLEVYNEISE-DQEPKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFS 117

Zfish   100 D-LGQDEPSLMFQQQYTFNLSGLSRLDELMEVELRVLRRPPQDVLSLLSYGGNLYRLLLHTCSLP 163
            . |..::.........|||.:.:.....|::..||:.::|     ||:....|.      |.|:.
  Fly   118 SRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQP-----SLVDRRANF------TVSVY 171

Zfish   164 GSLHQPLLLSSRTIDLLDTSSAT--WDVFDVGPIIKTPLK----QHR-----TAEDTRLLCLSIS 217
            ..|......|.|.:..::|:|:.  |..|::...::..|.    |.|     :..|::|...:..
  Fly   172 RKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISIGDSQLSTFAAG 236

Zfish   218 AVS-DSNNEAVHPGMLGLSREDQQTHERALLVAFSQARRKENLFREIREKIRAMKSRKFSNPTPE 281
            .|: .::..::.|.::|.....:      |||...:.|.|.:|     ||.||........|.|.
  Fly   237 LVTPQASRTSLEPFIVGYFNGPE------LLVKIQKLRFKRDL-----EKRRAGGGSPPPPPPPP 290

Zfish   282 HSIKGHPRHRRRRRTALAGRPGVGPITSGGKGGGRRRTRCSRKPLHVNFKELGWDDWIIAPLDYE 346
            ..:...|:                              .|.|....|:||||...:|:|||..:|
  Fly   291 VDLYRPPQ------------------------------SCERLNFTVDFKELHMHNWVIAPKKFE 325

Zfish   347 AYHCEGLCDFPLRSHLEPTNHAIIQTLMNSMDPESTPPSCCVPSKLSPISILYIDSGNNVVYKQY 411
            ||.|.|.|:|||.:.:..|||||:||||:...|. .|..||||:.|..|:||...:.:.:...:|
  Fly   326 AYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPH-LPKPCCVPTVLGAITILRYLNEDIIDLTKY 389

Zfish   412 EDMVVESCGC 421
            :..|.:.|||
  Fly   390 QKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gdf7XP_694563.2 TGFb_propeptide 62..250 CDD:279078 40/217 (18%)
TGFB 324..422 CDD:214556 41/97 (42%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 38/211 (18%)
TGFB 300..400 CDD:214556 43/100 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.