DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bmp2a and scw

DIOPT Version :9

Sequence 1:NP_571434.1 Gene:bmp2a / 30631 ZFINID:ZDB-GENE-980526-388 Length:386 Species:Danio rerio
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:433 Identity:99/433 - (22%)
Similarity:188/433 - (43%) Gaps:90/433 - (20%)


- Green bases have known domain annotations that are detailed below.


Zfish     8 LMVLMVTQVFFAGSSGL---------VPQVGRSSLSPDVLHAFELRLLSMFGLQHRP----TPST 59
            |.|..:|.:|:|.|:..         :|...:..||.      ::.::.:..|..||    .|:.
  Fly     2 LNVFFLTSLFYAASATTYVTTNNHIEMPIYQKRPLSE------QMEMIDILDLGDRPRRQAEPNL 60

Zfish    60 SAVVPQYMLDLYSAHSVNAEQVSRPRAHLGKGSERS--------------ASRANTIRSFHHDES 110
            .....:::|::|:..|.:.|    |:..|.:..:||              .:..|:|.:|   .|
  Fly    61 HNSASKFLLEVYNEISEDQE----PKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTF---SS 118

Zfish   111 TEDPSSSSVRTTQRFLFNLTSIPDEELVTSADVRVFREQIVSSLNNASAGFHRINVHEIIRPSGS 175
            ...|............||...:|.:..:..|.:|::::   .||.:..|.| .::|:   |...:
  Fly   119 RLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQ---PSLVDRRANF-TVSVY---RKLDN 176

Zfish   176 LQEPITRLLDTRLVQHSLSKWESFDVTPAVLKWTTDGHPNHGILVEISHPDQDSRKHVRVS---- 236
            .|:...|:|.:.....|...|..|::|..:..|.   | |.|:         ..|..:|:|    
  Fly   177 RQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWL---H-NKGL---------QRRNELRISIGDS 228

Zfish   237 ------RSLHNNEDTWSQMRPLLVTYSHDGKGNVLHSREKRQARNNKQRK--------------- 280
                  ..|...:.:.:.:.|.:|.| .:|...::..::.|..|:.::|:               
  Fly   229 QLSTFAAGLVTPQASRTSLEPFIVGY-FNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVD 292

Zfish   281 --KHKANCRRHSLYVDFSDVGWNDWIVAPPGYHAFYCQGECPFPLADHLNSTTNAMVQTLVNSVN 343
              :...:|.|.:..|||.::..::|::||..:.|::|.|.|.|||...:|:|.:|:||||::...
  Fly   293 LYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQ 357

Zfish   344 SNIPRACCVPTDLSPVSLL-YLDEYERVILKNYQDMVVEGCGC 385
            .::|:.|||||.|..:::| ||:| :.:.|..||..|.:.|||
  Fly   358 PHLPKPCCVPTVLGAITILRYLNE-DIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bmp2aNP_571434.1 TGFb_propeptide 28..256 CDD:279078 47/255 (18%)
TGFB 286..386 CDD:214556 40/101 (40%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 45/241 (19%)
TGFB 300..400 CDD:214556 40/101 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.