DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment six9 and Six4

DIOPT Version :9

Sequence 1:NP_001124080.1 Gene:six9 / 30623 ZFINID:ZDB-GENE-990621-11 Length:235 Species:Danio rerio
Sequence 2:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster


Alignment Length:231 Identity:114/231 - (49%)
Similarity:145/231 - (62%) Gaps:27/231 - (11%)


- Green bases have known domain annotations that are detailed below.


Zfish     5 FSPEQVACVCEVLLQSGSMDRLSSFLCSLPSISTSSNMYMGFGQSQESVLKARAAVAFHHCRFTE 69
            ||.:|:.|:||.|.|.|.:::|::||||||...        |.::.||||:|||.||::..:|.|
  Fly   181 FSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSE--------FFKTNESVLRARAMVAYNLGQFHE 237

Zfish    70 LYALLEGNVFSPRSHPLLQQLWLRAHYMEAELQRGRPLGAVGKYRIRRKFPLPRTIWDGEETSYC 134
            ||.|||.:.||.:.|..||.||.:|||.|||..||||||||.|||:|:|:|||:||||||||.||
  Fly   238 LYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYC 302

Zfish   135 FKEKSRSVLREWYCRKPYPSPREKRDLAAATGLTATQVSNWFKNRRQRDRAATSRQGTSAGAFLS 199
            ||||||:.|::.|....||:|.||:.||..||||.|||||||||||||||....|....:     
  Fly   303 FKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQRPDIMS----- 362

Zfish   200 SDEEISPPGSPRTLFSCSQQLSAHPPPLRHLGPAHY 235
                :.|.|          ||..:..|.....|::|
  Fly   363 ----VLPVG----------QLDGNGFPRMFNAPSYY 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
six9NP_001124080.1 SIX1_SD 5..122 CDD:293483 60/116 (52%)
homeodomain 133..184 CDD:238039 34/50 (68%)
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 60/116 (52%)
homeodomain 301..355 CDD:238039 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.