DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HCRTR2 and AstA-R2

DIOPT Version :9

Sequence 1:XP_016866287.1 Gene:HCRTR2 / 3062 HGNCID:4849 Length:461 Species:Homo sapiens
Sequence 2:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster


Alignment Length:341 Identity:91/341 - (26%)
Similarity:166/341 - (48%) Gaps:52/341 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    54 EWVLIAGYI---------IVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLP 109
            ||:.|.|.:         ::.:....||:||.:.|..|::||:.||..||||:.||::..|.|:|
  Fly    29 EWLAINGTLPWIVGFFFGVIAITGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIP 93

Human   110 ATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARN--- 171
            .|....:...|.:|:..|:.:.||..|:...|:.||..:::||:.|:.||:  :|...|..|   
  Fly    94 FTATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPI--RSRMMRTENITL 156

Human   172 -SIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAP 235
             :||.:|||..::.:|.|...:....:.  |.|...:.:|.......:.|:.|.:.||:.:|:.|
  Fly   157 IAIVTLWIVVLVVSVPVAFTHDVVVDYD--AKKNITYGMCTFTTNDFLGPRTYQVTFFISSYLLP 219

Human   236 LCLMVLAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR 300
            |.::...|:::..:||                           .|.|..|||.     :..|.|:
  Fly   220 LMIISGLYMRMIMRLW---------------------------RQGTGVRMSK-----ESQRGRK 252

Human   301 KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAANPIIYN 365
            :..|::::|::.||..:||:.::.:||.:..:..:|..:..:.   ..:..|.|::|..||::|.
  Fly   253 RVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQ---VTAQTLAYSSSCINPLLYA 314

Human   366 FLSGKFREEFKAAFSC 381
            |||..||:.|..|.:|
  Fly   315 FLSENFRKAFYKAVNC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HCRTR2XP_016866287.1 None
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 39/118 (33%)
7tm_1 55..313 CDD:278431 78/296 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.