DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fli1 and Eip74EF

DIOPT Version :9

Sequence 1:XP_021323256.1 Gene:fli1 / 30619 ZFINID:ZDB-GENE-980526-426 Length:474 Species:Danio rerio
Sequence 2:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster


Alignment Length:190 Identity:59/190 - (31%)
Similarity:86/190 - (45%) Gaps:48/190 - (25%)


- Green bases have known domain annotations that are detailed below.


Zfish   219 SSSSISYNTPSHADQSPRLAAKDDASYDAVRRTGWSNNMHSGKGSPTVVSQSVS----------- 272
            :::|:..::.|....:..|:|...|:..|....|         ||.:|:..:.|           
  Fly   701 AAASVVSSSSSAVAAAAMLSASAAAAATAAAAAG---------GSQSVIQPATSSVSYDLSYMLE 756

Zfish   273 ---------KNPDQPRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANAGC---ITWE 325
                     |.|.:|:        |.....|.:..|| ...||:|||:||.|  ...|   |.| 
  Fly   757 LGGFQQRKAKKPRKPK--------LEMGVKRRSREGS-TTYLWEFLLKLLQD--REYCPRFIKW- 809

Zfish   326 GTN---GEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 382
             ||   |.||:.|...|:|.||..|:||:|||:.:.|||||||.:.|:.||.|:|..|:|
  Fly   810 -TNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQF 868

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fli1XP_021323256.1 SAM_PNT-FLI-1 131..226 CDD:188883 1/6 (17%)
ETS 302..385 CDD:197710 41/87 (47%)
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 41/84 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.